KEGG   Caenorhabditis elegans (nematode): CELE_H02I12.6Help
Entry
CELE_H02I12.6     CDS       T00019                                 

Gene name
his-66
Definition
Protein HIS-66
Orthology
K11252  
histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(11400393..11400764)
Genome map
AA seq 123 aa AA seqDB search
MPPKPSAKGAKKAAKTVVAKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIM
NSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagccatctgccaagggagccaagaaggccgccaagaccgtcgttgccaag
ccaaaggacggaaagaagagacgtcatgcccgcaaggaatcgtactccgtctacatctac
cgtgttctcaagcaagttcacccagacaccggagtctcctccaaggccatgtctatcatg
aactccttcgtcaacgatgtattcgaacgcatcgcttcggaagcttcccgtcttgctcat
tacaacaaacgctcaacgatctcatcccgcgaaattcaaaccgctgtccgtttgattctc
ccaggagaacttgccaagcacgccgtgtctgagggaaccaaggccgtcaccaagtacact
tccagcaagtaa

DBGET integrated database retrieval system