KEGG   Caenorhabditis elegans (nematode): CELE_H06O01.1Help
Entry
CELE_H06O01.1     CDS       T00019                                 

Gene name
pdi-3
Definition
Protein PDI-3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_H06O01.1 (pdi-3)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CELE_H06O01.1 (pdi-3)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CELE_H06O01.1 (pdi-3)
  Exosomal proteins of colorectal cancer cells
   CELE_H06O01.1 (pdi-3)
  Exosomal proteins of bladder cancer cells
   CELE_H06O01.1 (pdi-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(7016137..7016302,7016354..7016430,7016793..7017021,7017101..7017400,7017451..7017564,7017621..7017744,7017791..7018016,7020557..7020787))
Genome map
AA seq 488 aa AA seqDB search
MIWVQAALVASFLAFASAGGAVLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYE
RAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIV
KFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESKLKDSYLKVADTERDRFSFAH
TSNKDIIKKAGYSDDVVVFVPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHETVGFAGIRT
QGNLFQFEQKPIVIVYYNVDYVKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEI
ETNGLGERKDSDKPIVAILTNEGKYPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDE
QGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDVIIAKMD
ATANDVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISKHSTDGLKGFSRDG
KKKKKTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatttgggtccaggcagctttggtcgcctccttcctggcgttcgccagtgctggagga
gccgttctcgagtataccgacggaaacttcgatgatctcatccaaacccacgacattgct
cttgtcaagttctacgctccctggtgcggacactgcaagaaaattgccccagagtatgag
agagctgccccaaaactcgcatctaacgatccaccagtcgctctcgtcaaggtcgattgt
accaccgagaagactgtttgtgacaaattcggagttaagggattcccaactcttaagatc
ttccgcaatggagttccagcccaagactacgatggaccacgtgatgccgatggtatcgtt
aagttcatgcgcggacagtcgggaccttcttccaaggaacttaagaccgttgccgaattc
gagaagttcactggtggagatgaaaatgttgtcatcggattcttcgagagcgaaagcaag
cttaaggattcttatctcaaggttgctgataccgaacgtgatcgtttctccttcgctcac
acttccaacaaagacatcatcaagaaggctggatactctgatgacgtcgttgtcttcgtt
ccaaaaaagctccataacaagtttgacactaacgagttcaaatatgatggtaactacgac
accgataagattaagaacttcttggtccatgaaactgttggatttgccggaattcgtact
caaggaaacttgttccaattcgagcaaaagccaatcgtcattgtttactacaacgttgat
tacgtcaaggatcctaagggatccaactactggcgcaaccgtgtcttgaaagttgctcaa
aactataagagaaaagttcaattcgccgtttccaacaaagaagaattctcttctgaaatt
gaaaccaatggactaggagagcgcaaggactcggataagccaatcgttgccattctcact
aatgaaggaaagtatccaatggaccaagaattcagcgttgacaatctccagcaattcgtt
gatgaagttctcgccggaaatgccgaaccatacatgaagtctgagccaatcccagatgaa
caaggagacgttaaggttgccgttggaaagaacttcaaggaacttatcatggatgctgat
aaggatgtgctcattgaattttatgctccatggtgcggacattgcaaatcattggctcca
aaatacgaggaacttgctgagaagctcaacaaggaagatgttatcattgctaagatggat
gccaccgccaatgatgttccaccaatgttcgaagttagaggattcccaactctcttctgg
cttccaaagaacgctaagtcgaacccgatcccatacaatggaggacgcgaagttaaggat
ttcgtcagcttcatctcaaagcactctactgatgggctcaagggtttcagccgcgacgga
aagaagaagaagaagactgaattgtaa

DBGET integrated database retrieval system