KEGG   Caenorhabditis elegans (nematode): CELE_H06O01.1Help
Entry
CELE_H06O01.1     CDS       T00019                                 

Gene name
pdi-3
Definition
Protein PDI-3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cel04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(7016136..7016301,7016353..7016429,7016792..7017020,7017100..7017399,7017450..7017563,7017620..7017743,7017790..7018015,7020556..7020786))
Genome map
AA seq 488 aa AA seqDB search
MIWVQAALVASFLAFASAGGAVLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYE
RAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIV
KFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESKLKDSYLKVADTERDRFSFAH
TSNKDIIKKAGYSDDVVVFVPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHETVGFAGIRT
QGNLFQFEQKPIVIVYYNVDYVKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEI
ETNGLGERKDSDKPIVAILTNEGKYPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDE
QGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDVIIAKMD
ATANDVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISKHSTDGLKGFSRDG
KKKKKTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatttgggtccaggcagctttggtcgcctccttcctggcgttcgccagtgctggagga
gccgttctcgagtataccgacggaaacttcgatgatctcatccaaacccacgacattgct
cttgtcaagttctacgctccctggtgcggacactgcaagaaaattgccccagagtatgag
agagctgccccaaaactcgcatctaacgatccaccagtcgctctcgtcaaggtcgattgt
accaccgagaagactgtttgtgacaaattcggagttaagggattcccaactcttaagatc
ttccgcaatggagttccagcccaagactacgatggaccacgtgatgccgatggtatcgtt
aagttcatgcgcggacagtcgggaccttcttccaaggaacttaagaccgttgccgaattc
gagaagttcactggtggagatgaaaatgttgtcatcggattcttcgagagcgaaagcaag
cttaaggattcttatctcaaggttgctgataccgaacgtgatcgtttctccttcgctcac
acttccaacaaagacatcatcaagaaggctggatactctgatgacgtcgttgtcttcgtt
ccaaaaaagctccataacaagtttgacactaacgagttcaaatatgatggtaactacgac
accgataagattaagaacttcttggtccatgaaactgttggatttgccggaattcgtact
caaggaaacttgttccaattcgagcaaaagccaatcgtcattgtttactacaacgttgat
tacgtcaaggatcctaagggatccaactactggcgcaaccgtgtcttgaaagttgctcaa
aactataagagaaaagttcaattcgccgtttccaacaaagaagaattctcttctgaaatt
gaaaccaatggactaggagagcgcaaggactcggataagccaatcgttgccattctcact
aatgaaggaaagtatccaatggaccaagaattcagcgttgacaatctccagcaattcgtt
gatgaagttctcgccggaaatgccgaaccatacatgaagtctgagccaatcccagatgaa
caaggagacgttaaggttgccgttggaaagaacttcaaggaacttatcatggatgctgat
aaggatgtgctcattgaattttatgctccatggtgcggacattgcaaatcattggctcca
aaatacgaggaacttgctgagaagctcaacaaggaagatgttatcattgctaagatggat
gccaccgccaatgatgttccaccaatgttcgaagttagaggattcccaactctcttctgg
cttccaaagaacgctaagtcgaacccgatcccatacaatggaggacgcgaagttaaggat
ttcgtcagcttcatctcaaagcactctactgatgggctcaagggtttcagccgcgacgga
aagaagaagaagaagactgaattgtaa

DBGET integrated database retrieval system