KEGG   Caenorhabditis elegans (nematode): CELE_H19N07.2Help
Entry
CELE_H19N07.2     CDS       T00019                                 

Gene name
math-33
Definition
(RefSeq) MATH-33, isoform K
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CELE_H19N07.2 (math-33)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_H19N07.2 (math-33)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_H19N07.2 (math-33)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
V:join(11114044..11114255,11114301..11114645,11114788..11115254,11115421..11116382,11116427..11116544,11116589..11117381,11117431..11117545,11117599..11117844,11117886..11117964,11118074..11118153)
Genome map
AA seq 1138 aa AA seqDB search
MQCSPDPEDLLIVPTHDIPSYDESLDPFGPEGHLSLDIDCFSKFMSRSDNRIMSKPIIVR
GIPWRILAICRGSRNQQGSRHSMNSRVNRSNFNFGFFLQCNNDELLQKRGMWRCYGTAVL
EVLNADGPSIQKKIHHSFHNTEVDWGFSNYDQYDTLCNPKDGYVVNDTIKLRCRFTADVP
TGANYMWDSKRHTGCIGLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVL
AMQRVFYELQMASEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEK
SIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENK
YDAGDHGLQRAEKGVKFVELPPILHVQLMRFQYCGVEQKINERFSFPEKMNLASCCELGP
MLTEEDCVYSLHAVLVHSGEFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTT
DDAIVSNFGGEKTMNSSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEMERLHRNREK
KKLEEEQLCMGIVLVTPDIVASNHSFDLVDQSIVHDSIPHETVWKHMFTAELYQFVHDRL
FEKSAMQKIDMFDSDDEARQARRDNLRRIKSKKFNFRLWRMTDSYSLERTTQKLTSRLRP
SEFIDCKTDTRLDTLLSQDFETIYVEFSNNIERPLCEYDTARDLLFFVKYYDTMTDKFTI
IGHTMFDCHKRFNLYRSMLCEMIGLPADTELKYYMEHAASYLELVDLTQNYSIGRLVEEQ
DGGILVVEKVETSTSTQNAKQKMNELFLDVEVEFVQSFYNKKPEEEPFEQFVKRICLDDK
LFTVAEEIGARLNVDPKKVLIWTRVSGSRFEPFFDDYMLNTCKGLMTRPVHDPRAYKRYR
VQYAIMPFDIDEISKHRIQTKLFWQLPNGHVEELTLFPLKEGTVIDIINEAKRYYPFVEG
GSGKFRLLQIGAPPLSNQRVYQIYGENTLISDLDQRTMYKLVSSQALHCRLEEVPIDELD
MSPGEFLCPVVHFDREPTKLFGLSFVIKIRNNELMTEVRDRLRRKLNDVSDADFAKYKFA
LLSRDKLQLCRTIEFNNGEKVNLADMANQTTGVPQVYIGLDHKSPIQHSSEAAIRILN
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgctcgccggatcccgaagatctactcattgtgccgacgcacgatataccatcc
tatgatgaaagtttggatccattcgggccagaaggccatttgtccttggacattgactgc
ttttcgaagtttatgtctcgttcagacaatcggattatgtccaagccaattatcgttcgt
ggcatcccttggcgtattctagccatttgcagaggttccagaaatcaacaaggaagtcgg
cattcgatgaactctcgtgtcaaccgcagcaattttaacttcgggttctttctgcagtgc
aacaatgatgagttgctgcagaaacgtggaatgtggcgatgctatggaacggccgttttg
gaagttcttaatgcggatggtccatcgattcagaaaaagattcatcattcatttcacaat
acggaggttgattggggattttcaaattatgaccagtatgacaccctgtgcaaccccaaa
gatggatacgtagtgaatgacactatcaaattgagatgtcgtttcactgctgatgttccg
actggagccaactatatgtgggatagcaaacggcacactggttgcatcggattaagaaac
caaggagccacttgttacatgaactccatattgcaatcattctacttcaccacaggattc
agacgcgctgtctacaacatggatgtaggaacagagccgaatgagagcaacattgtgctt
gcaatgcagagagttttctatgaactccagatggctagtgaagctgtcgaaacgaacagt
ctcacgagagcttttggatgggataagcttgatgcgttcaatcaacatgatgttcaagag
ttttgtcgtgttcttcttgacaatctcgaaacaaagatgaaaggaacatccgaggagaag
tcaatcccaaacttattcagaggaaacatgaagtcatatatcaaatgtcttgatgtggac
tatgaaagttcgcggactgaatcattctacgacgtacagctcaatgtacttgggatggat
agcttggaacgtgcattcgaagcttacacaacatcagaaatcctcgatgatgagaacaag
tatgatgctggagaccacggactacaaagagcggaaaagggagtaaaattcgtcgagctt
ccaccaatcctgcacgttcagctcatgcgatttcaatattgcggtgtcgaacaaaagatc
aacgaacggttctcatttccggagaaaatgaacttggcatcttgttgcgagttaggacca
atgctcaccgaagaagactgtgtgtacagtctccacgcggttcttgttcacagtggagag
ttccatggaggtcactatgtcacctatatcaatgtcaatcttcacgaatcggccgtcgat
ccaacttcatctgctaaatggtgcaagtttgatgatgatgttgtttctagaacaacaaca
gatgatgccatcgtaagcaatttcggaggagagaagacaatgaattcttcggcttatatg
ttggtctacgtccgtgataacgcgattgatcaattccttgctccaatcccagacagccag
ataccacaatctgtttctcgtacttttgaaatggaaaggctgcacagaaaccgtgagaag
aaaaaattggaggaagaacagctgtgtatggggatagttcttgtgacaccagatattgtt
gcctctaatcattctttcgatcttgttgatcaatccatagtccatgacagtattccacac
gagactgtttggaagcatatgttcaccgccgagctttatcaatttgttcatgatagactt
ttcgagaagagcgcaatgcaaaaaattgatatgttcgattcggatgatgaagctagacag
gcacggcgtgataatcttcgtcgcattaaatcgaaaaaattcaacttccgtttgtggaga
atgacagattcatattcattggaaagaacaactcagaaattgacttcaagactgagacca
tcggagttcatcgattgcaaaactgatacacgccttgataccttgttgagccaagatttt
gaaactatctacgttgagttctccaacaatattgaacgcccgctttgcgaatatgacaca
gcaagggaccttctatttttcgtaaaatattacgacacaatgaccgacaagtttactatc
atcggccatacaatgttcgactgtcacaagcggtttaatttgtacagatcgatgttatgt
gaaatgattgggctacccgctgacacggagttgaagtattatatggagcatgctgcgagt
tatctggaactggttgatcttacccaaaattattcgatcggaagactcgttgaagagcaa
gacggtggtattctagtagttgagaaggtcgagacatctacatccacacaaaatgccaag
cagaagatgaatgaacttttcctcgacgtagaagttgaatttgttcaatcgttctacaac
aaaaagccggaggaagagccatttgaacaattcgtcaagagaatttgtctggacgataaa
ttattcactgtagcagaggaaattggtgcaagattgaatgtagacccaaagaaagtactc
atctggacacgtgtgtctggttctcgattcgagccatttttcgatgattacatgttaaac
acatgcaaaggacttatgacaagaccggtacatgatcccagagcctacaagaggtatcgt
gtacaatatgctatcatgcccttcgatattgatgaaatcagtaagcaccgtattcaaacc
aaacttttctggcaacttccaaatggacatgtagaagagctaacactgttcccattgaaa
gaaggaactgtcattgatattattaacgaggcaaaacgatactatccattcgtagaagga
ggatcaggaaaattcaggcttctacaaattggggctcccccactcagtaatcaacgtgtt
tatcaaatttacggagaaaacaccttgattagtgatcttgatcaacgaacaatgtacaaa
ttggtgagttcacaggctctacattgccgccttgaggaggttccgattgacgaattagat
atgtcacctggcgagtttctatgcccagtcgtccattttgatcgagaacccacaaaactt
ttcggactctcatttgttatcaaaatacgtaacaatgagctgatgacagaagtacgggat
cgtcttcgtaggaaattgaacgatgtctccgatgctgactttgccaaatacaagtttgca
ttgcttagcagagataaacttcagctctgtcgtaccatcgaattcaacaacggcgagaaa
gtcaacctggcagatatggcaaatcaaacaactggagttccacaagtgtacattggtcta
gatcacaaatcacccatccaacattcaagtgaagctgccatccgaatcttgaactga

DBGET integrated database retrieval system