KEGG   Caenorhabditis elegans (nematode): CELE_H34C03.2Help
Entry
CELE_H34C03.2     CDS       T00019                                 

Gene name
H34C03.2
Definition
Protein H34C03.2
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_H34C03.2 (H34C03.2)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_H34C03.2 (H34C03.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(6757343..6757417,6757465..6757642,6757689..6757879,6757926..6757989,6758037..6758176,6758223..6758314,6759546..6759783,6759830..6760369,6760417..6760565,6760619..6761398,6761475..6761617,6761664..6761776)
Genome map
AA seq 900 aa AA seqDB search
MPTPEDVPMDENDAGRVAEGSQDESKTPSREVLKKLLNEVEMAEMEENEMWYLISQKWWN
SLIKAVRDGFVDDVGPIDNSQISECRNGSFFLKQRLAEQVDYTPVPEILFKRLERFYHID
DDRRDYIQRRVVRKDGKLCIEVYPRIVHITSARNRDIKADLVLRPDDTMVSLRERVIGEL
SLSTTDNIRFYVMNGENYELIDTAQSIDSYFDTVQKVVVDVEEDGEFFIKGKSATPKSLF
GTQSSSSHGGNGISNSYNSPSPSTGVVTRTTPGACGLSNLGNTCFMASAFQCLSNMPPLR
EYFLANTYQNDINEDNPLGTHGHLAMAVGELMKGMWSGDYASINPRKFKSIIGQFAPRFN
GYSQQDAHELMAYVLDGLHEDLNRIKKKPYIEDSDEDAKLPEAEYAAKSWEVYKMRNDSI
IVDTLHGQLKSTLICPVCEKISIKFDPFGYLSLPLPPKEQIVKQTVIVMFLTRKWAKFSL
GITDTTTVEEAERLMLDKLQPEQQHHFVFFHVPSQYHDDITMMRPGDRVRMPGREVYVAE
VEHDLQVKGTRLFVAYNRIKLVRSASLPMIYSLPTGYPLTRGFLNDHVFSTTKHFFINPK
AVAELGGGNSNDDDSMSGSNSADEREPYKLFVGPPGSTASLPIPPTDDPIPFPDENSHDI
YSNFLQIVFQWKDLKIFNQYKGNELIEREMTVSTRRKVLLQETLDWFTTKEQLGEQDSWY
CPQCKKHERATKQLALWKLPEILILHLKRFQYTKWSREKLTWEVVIPVRGLDLTDKVANP
NHEKAIYDLIAVSRHYGSLSGGHYTAIGYNDREQKWFDFNDSSANPTYPPAEPYESSDPY
ILVYRRRKLDSNGKPIEPSAVSESLHSRPKRGAAPTISSATSSASSSRHQVDENMEMEED
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgccaactcccgaggatgttcccatggatgaaaatgacgcaggaagagtagcagaaggc
tcccaggatgaatctaaaacaccttcccgtgaagtgcttaagaaacttcttaacgaggtt
gagatggctgaaatggaggaaaatgaaatgtggtacttgatcagccaaaagtggtggaat
tcgttgatcaaagcagttcgtgatggctttgttgatgacgttgggccaattgacaattca
cagatatcggaatgccgaaacggatcattctttctgaaacaacgacttgccgagcaagta
gactatactccagttccagagattctgttcaaacgtcttgaaagattctatcacattgat
gatgatcgtcgggactatattcagcgtcgagttgtccggaaggatggaaaattatgtatt
gaagtatatccgagaatcgttcatatcacctccgccagaaatcgtgacatcaaagccgat
ttggttcttcgaccggatgacacaatggtctctctgcgggaacgtgtaattggggagctt
tctctttccaccacagacaatattcgtttctatgtgatgaacggagaaaattatgaactt
atcgatacagcacagtcaattgatagttattttgatacagttcaaaaggtggtagttgat
gtagaagaagatggagaattctttatcaagggaaaaagtgcaacgcctaaatcacttttt
gggactcaatcctcttcgtcacatggaggaaatggaatctctaattcctacaactcccca
tctccttccactggcgtcgtcactcgtacaactcccggagcctgtggactttccaattta
ggaaacacctgcttcatggcatcagcatttcagtgtttgagcaacatgcccccactccgg
gaatatttcctagcgaatacatatcaaaacgacatcaacgaggataatcctttgggaacc
catggtcacttggctatggccgttggagaacttatgaaaggaatgtggagtggcgactac
gcgtctataaatccccgaaagttcaaatcaattattggacaatttgcaccacgatttaac
ggatactcgcaacaagacgctcacgagctaatggcctatgttctcgatggactacacgag
gatctgaatcgtataaagaagaaaccatacattgaggatagtgatgaagatgcgaaacta
ccggaagctgaatatgctgcaaagtcatgggaagtgtataaaatgcgaaatgattcgata
attgtggacactttgcatggacagctcaaatctacactgatttgtcctgtatgtgaaaag
atttctatcaagttcgatccattcggatacctttcacttccacttcctccaaaagaacaa
attgtcaaacagacagtgatcgtgatgttcttgaccagaaaatgggccaagttttcacta
ggaatcactgacactacaacagttgaagaagctgagagattgatgttggataagttacag
cctgaacagcaacatcatttcgtgttcttccacgttcctagccaatatcatgatgatata
acgatgatgcggcctggtgacagagtccgaatgcctggacgtgaagtatatgtggctgaa
gttgagcatgatctgcaggttaaagggacccgtctctttgttgcctataatcgtatcaag
cttgtccgttctgcgtctcttccaatgatctattctctgccaactggctacccattgact
cgtggattcctgaatgaccatgtattttctactacaaaacatttcttcataaatccaaag
gctgtcgctgaactcggaggtggaaattccaatgatgacgattcgatgagcggaagcaac
tctgccgatgaacgagaaccatataagttgtttgtcggaccgcctggatcaacagcttct
cttccgatcccaccaacggacgatccaatcccgttccctgatgaaaattctcatgacatt
tacagtaacttcctacaaatcgttttccaatggaaggatctcaagattttcaatcaatac
aagggaaatgagttgatagaacgcgagatgaccgtttctactcgtcggaaagttcttttg
caagagactctggactggttcacaacgaaagaacaactcggagaacaggattcgtggtac
tgtcctcaatgcaagaaacacgagcgagccacgaagcaattagctctgtggaagcttccg
gagattctcattctccacttgaaacgtttccaatacaccaagtggtctcgtgagaagctg
acatgggaggttgtgattcctgttcgtgggttggatcttaccgacaaagttgccaatccg
aatcacgagaaagcgatctacgaccttattgccgtatcacgtcactatggatccttgagt
ggaggtcattacactgccataggctacaacgacagggaacagaaatggtttgatttcaac
gattcctcagcaaatccgacatatcctccagctgaaccctatgagtcgagcgatccctac
attcttgtataccgaagacgcaaattggattcaaatggaaaaccgattgagccatcagca
gtatctgaatctcttcatagtcgaccgaaaagaggagctgctccaacaatttcatctgca
acatcatcagcttcatcgtctcgccatcaagttgacgaaaatatggagatggaggaagat
tga

DBGET integrated database retrieval system