KEGG   Caenorhabditis elegans (nematode): CELE_H34C03.2Help
Entry
CELE_H34C03.2     CDS       T00019                                 

Gene name
H34C03.2
Definition
Protein H34C03.2
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(6757332..6757406,6757454..6757631,6757678..6757868,6757915..6757978,6758026..6758165,6758212..6758303,6759535..6759772,6759819..6760358,6760406..6760554,6760608..6761387,6761464..6761606,6761653..6761765)
Genome map
AA seq 900 aa AA seqDB search
MPTPEDVPMDENDAGRVAEGSQDESKTPSREVLKKLLNEVEMAEMEENEMWYLISQKWWN
SLIKAVRDGFVDDVGPIDNSQISECRNGSFFLKQRLAEQVDYTPVPEILFKRLERFYHID
DDRRDYIQRRVVRKDGKLCIEVYPRIVHITSARNRDIKADLVLRPDDTMVSLRERVIGEL
SLSTTDNIRFYVMNGENYELIDTAQSIDSYFDTVQKVVVDVEEDGEFFIKGKSATPKSLF
GTQSSSSHGGNGISNSYNSPSPSTGVVTRTTPGACGLSNLGNTCFMASAFQCLSNMPPLR
EYFLANTYQNDINEDNPLGTHGHLAMAVGELMKGMWSGDYASINPRKFKSIIGQFAPRFN
GYSQQDAHELMAYVLDGLHEDLNRIKKKPYIEDSDEDAKLPEAEYAAKSWEVYKMRNDSI
IVDTLHGQLKSTLICPVCEKISIKFDPFGYLSLPLPPKEQIVKQTVIVMFLTRKWAKFSL
GITDTTTVEEAERLMLDKLQPEQQHHFVFFHVPSQYHDDITMMRPGDRVRMPGREVYVAE
VEHDLQVKGTRLFVAYNRIKLVRSASLPMIYSLPTGYPLTRGFLNDHVFSTTKHFFINPK
AVAELGGGNSNDDDSMSGSNSADEREPYKLFVGPPGSTASLPIPPTDDPIPFPDENSHDI
YSNFLQIVFQWKDLKIFNQYKGNELIEREMTVSTRRKVLLQETLDWFTTKEQLGEQDSWY
CPQCKKHERATKQLALWKLPEILILHLKRFQYTKWSREKLTWEVVIPVRGLDLTDKVANP
NHEKAIYDLIAVSRHYGSLSGGHYTAIGYNDREQKWFDFNDSSANPTYPPAEPYESSDPY
ILVYRRRKLDSNGKPIEPSAVSESLHSRPKRGAAPTISSATSSASSSRHQVDENMEMEED
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgccaactcccgaggatgttcccatggatgaaaatgacgcaggaagagtagcagaaggc
tcccaggatgaatctaaaacaccttcccgtgaagtgcttaagaaacttcttaacgaggtt
gagatggctgaaatggaggaaaatgaaatgtggtacttgatcagccaaaagtggtggaat
tcgttgatcaaagcagttcgtgatggctttgttgatgacgttgggccaattgacaattca
cagatatcggaatgccgaaacggatcattctttctgaaacaacgacttgccgagcaagta
gactatactccagttccagagattctgttcaaacgtcttgaaagattctatcacattgat
gatgatcgtcgggactatattcagcgtcgagttgtccggaaggatggaaaattatgtatt
gaagtatatccgagaatcgttcatatcacctccgccagaaatcgtgacatcaaagccgat
ttggttcttcgaccggatgacacaatggtctctctgcgggaacgtgtaattggggagctt
tctctttccaccacagacaatattcgtttctatgtgatgaacggagaaaattatgaactt
atcgatacagcacagtcaattgatagttattttgatacagttcaaaaggtggtagttgat
gtagaagaagatggagaattctttatcaagggaaaaagtgcaacgcctaaatcacttttt
gggactcaatcctcttcgtcacatggaggaaatggaatctctaattcctacaactcccca
tctccttccactggcgtcgtcactcgtacaactcccggagcctgtggactttccaattta
ggaaacacctgcttcatggcatcagcatttcagtgtttgagcaacatgcccccactccgg
gaatatttcctagcgaatacatatcaaaacgacatcaacgaggataatcctttgggaacc
catggtcacttggctatggccgttggagaacttatgaaaggaatgtggagtggcgactac
gcgtctataaatccccgaaagttcaaatcaattattggacaatttgcaccacgatttaac
ggatactcgcaacaagacgctcacgagctaatggcctatgttctcgatggactacacgag
gatctgaatcgtataaagaagaaaccatacattgaggatagtgatgaagatgcgaaacta
ccggaagctgaatatgctgcaaagtcatgggaagtgtataaaatgcgaaatgattcgata
attgtggacactttgcatggacagctcaaatctacactgatttgtcctgtatgtgaaaag
atttctatcaagttcgatccattcggatacctttcacttccacttcctccaaaagaacaa
attgtcaaacagacagtgatcgtgatgttcttgaccagaaaatgggccaagttttcacta
ggaatcactgacactacaacagttgaagaagctgagagattgatgttggataagttacag
cctgaacagcaacatcatttcgtgttcttccacgttcctagccaatatcatgatgatata
acgatgatgcggcctggtgacagagtccgaatgcctggacgtgaagtatatgtggctgaa
gttgagcatgatctgcaggttaaagggacccgtctctttgttgcctataatcgtatcaag
cttgtccgttctgcgtctcttccaatgatctattctctgccaactggctacccattgact
cgtggattcctgaatgaccatgtattttctactacaaaacatttcttcataaatccaaag
gctgtcgctgaactcggaggtggaaattccaatgatgacgattcgatgagcggaagcaac
tctgccgatgaacgagaaccatataagttgtttgtcggaccgcctggatcaacagcttct
cttccgatcccaccaacggacgatccaatcccgttccctgatgaaaattctcatgacatt
tacagtaacttcctacaaatcgttttccaatggaaggatctcaagattttcaatcaatac
aagggaaatgagttgatagaacgcgagatgaccgtttctactcgtcggaaagttcttttg
caagagactctggactggttcacaacgaaagaacaactcggagaacaggattcgtggtac
tgtcctcaatgcaagaaacacgagcgagccacgaagcaattagctctgtggaagcttccg
gagattctcattctccacttgaaacgtttccaatacaccaagtggtctcgtgagaagctg
acatgggaggttgtgattcctgttcgtgggttggatcttaccgacaaagttgccaatccg
aatcacgagaaagcgatctacgaccttattgccgtatcacgtcactatggatccttgagt
ggaggtcattacactgccataggctacaacgacagggaacagaaatggtttgatttcaac
gattcctcagcaaatccgacatatcctccagctgaaccctatgagtcgagcgatccctac
attcttgtataccgaagacgcaaattggattcaaatggaaaaccgattgagccatcagca
gtatctgaatctcttcatagtcgaccgaaaagaggagctgctccaacaatttcatctgca
acatcatcagcttcatcgtctcgccatcaagttgacgaaaatatggagatggaggaagat
tga

DBGET integrated database retrieval system