KEGG   Caenorhabditis elegans (nematode): CELE_K03B8.1Help
Entry
CELE_K03B8.1      CDS       T00019                                 

Gene name
nas-16
Definition
(RefSeq) Zinc metalloproteinase nas-16
  KO
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_K03B8.1 (nas-16)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_K03B8.1 (nas-16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
V:join(11392320..11392484,11392556..11392972,11393029..11393270,11393319..11393508)
Genome map
AA seq 337 aa AA seqDB search
MKFAMNFISSQTCVTFEENCTISTRIKFVDSTFCASYVGMINSVQEIYFPDWCMRFGSAV
HELMHALGVLHTHARFDRDNFLNVNLNKDDEDDSNFEIVSPPFSINVVPYEYGSTLHYTA
DVSGTNSLLPKQMEYYRTLGNRRVTFYDMLTINTAYNCKCPSELLCANGGYTNPSNCLEC
ICPLGYGGVLCDRVVACSVQLSADSYWKGSWISVGSSVLRDTTDPVKAFISINAPKDKII
EVKIVKIENFSCDSGCNNNGVEIKYMGDPRITNPIICCENQVDPSNKGYKAKLNPLLINI
YTFLGKNKVTFHYRYVNERLSSYNKTTNGYDNYEYYA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgctatgaacttcatatcttcacaaacttgcgttactttcgaagaaaactgt
actatttcaacgagaataaaatttgttgacagtactttctgtgcttcatatgttggaatg
attaacagtgtacaagaaatttattttcctgactggtgcatgcggtttggatccgccgtt
cacgaactaatgcatgcattgggtgttctgcacactcatgctcgttttgatcgagataac
tttcttaatgtaaatctgaacaaagatgatgaagacgacagcaattttgagattgtttct
cctcccttttctataaacgttgtaccatatgagtatggaagcactttgcactatacagcc
gatgtatcgggaacaaattcacttcttccgaaacaaatggaatattatagaacactagga
aatcgaagagttacattttatgatatgttaactataaacactgcatacaactgcaaatgt
ccaagtgaattattgtgtgcaaatggaggatatacaaatccgtccaattgtttggaatgt
atttgtccattgggatatggaggagtgttatgtgatcgagtagttgcttgtagtgtccag
ttaagtgcagattcgtattggaaaggatcctggatttctgttggaagtagtgttttgaga
gatactacagaccccgttaaagcgtttatctcaataaatgctccgaaagataaaattatt
gaagttaaaattgtgaaaatagaaaatttctcgtgtgactctggttgcaataataatgga
gtggagattaaatacatgggggatccaagaatcactaatccaattatttgctgtgagaat
caagtggacccatccaacaagggatacaaagccaagctgaatccacttttgattaatatt
tatacatttctcgggaaaaacaaagtgaccttccattacagatatgtgaatgaacgcttg
agtagctacaataaaaccacaaatggatatgataactatgaatattatgcctaa

DBGET integrated database retrieval system