KEGG   Caenorhabditis elegans (nematode): CELE_K03B8.1Help
Entry
CELE_K03B8.1      CDS       T00019                                 

Gene name
nas-16
Definition
Protein NAS-16
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(11391914..11392103,11392150..11392466,11392538..11392954,11393011..11393252,11393301..11393490)
Genome map
AA seq 451 aa AA seqDB search
MGNLFKFSLNCIKYRSENLEKSKMFYQYFYFHLTLSIVLIYGSDIGKDANEHMSSVPKKI
IIEGTRQKRQVVTKLFSPQWSNAKVFYCNADSFSKLQLKKLKLKKNSDTVKRKLMKFAMN
FISSQTCVTFEENCTISTRIKFVDSTFCASYVGMINSVQEIYFPDWCMRFGSAVHELMHA
LGVLHTHARFDRDNFLNVNLNKDDEDDSNFEIVSPPFSINVVPYEYGSTLHYTADVSGTN
SLLPKQMEYYRTLGNRRVTFYDMLTINTAYNCKCPSELLCANGGYTNPSNCLECICPLGY
GGVLCDRVVACSVQLSADSYWKGSWISVGSSVLRDTTDPVKAFISINAPKDKIIEVKIVK
IENFSCDSGCNNNGVEIKYMGDPRITNPIICCENQVDPSNKGYKAKLNPLLINIYTFLGK
NKVTFHYRYVNERLSSYNKTTNGYDNYEYYA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacttgtttaaattcagcttgaactgtataaaatatcgttctgaaaatctagaa
aaatctaaaatgttttatcaatatttttattttcatctgacactttcaattgttctcata
tatggatcagatattggaaaagatgctaatgaacatatgtccagcgttccaaaaaaaata
attattgaaggaacccgtcagaaaagacaagtagtgactaaattattttctccacagtgg
tccaatgctaaagtattttattgtaatgccgattcattcagtaagctccaactcaaaaag
ttaaaattaaaaaaaaactcagatactgtaaaacgaaaattaatgaaatttgctatgaac
ttcatatcttcacaaacttgcgttactttcgaagaaaactgtactatttcaacgagaata
aaatttgttgacagtactttctgtgcttcatatgttggaatgattaacagtgtacaagaa
atttattttcctgactggtgcatgcggtttggatccgccgttcacgaactaatgcatgca
ttgggtgttctgcacactcatgctcgttttgatcgagataactttcttaatgtaaatctg
aacaaagatgatgaagacgacagcaattttgagattgtttctcctcccttttctataaac
gttgtaccatatgagtatggaagcactttgcactatacagccgatgtatcgggaacaaat
tcacttcttccgaaacaaatggaatattatagaacactaggaaatcgaagagttacattt
tatgatatgttaactataaacactgcatacaactgcaaatgtccaagtgaattattgtgt
gcaaatggaggatatacaaatccgtccaattgtttggaatgtatttgtccattgggatat
ggaggagtgttatgtgatcgagtagttgcttgtagtgtccagttaagtgcagattcgtat
tggaaaggatcctggatttctgttggaagtagtgttttgagagatactacagaccccgtt
aaagcgtttatctcaataaatgctccgaaagataaaattattgaagttaaaattgtgaaa
atagaaaatttctcgtgtgactctggttgcaataataatggagtggagattaaatacatg
ggggatccaagaatcactaatccaattatttgctgtgagaatcaagtggacccatccaac
aagggatacaaagccaagctgaatccacttttgattaatatttatacatttctcgggaaa
aacaaagtgaccttccattacagatatgtgaatgaacgcttgagtagctacaataaaacc
acaaatggatatgataactatgaatattatgcctaa

DBGET integrated database retrieval system