KEGG   Caenorhabditis elegans (nematode): CELE_K03B8.2Help
Entry
CELE_K03B8.2      CDS       T00019                                 

Gene name
nas-17
Definition
Protein NAS-17
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(11398898..11399207,11399258..11399442,11399562..11399981,11400030..11400271,11400321..11400510)
Genome map
AA seq 448 aa AA seqDB search
MQKYQLYKTMEDVKENHFDMFLRPSTLLLTLFLALVAGSAIRKDVDEFDSNKGKDGIVDG
DIMLTEAQLRILNGTAKRSKRQITKIWKKWPDAKVFYYYENEFTSLKRELMSYAMAHISS
NTCVKFQESNSATNRIRFTNTGGCASYIGMNGGEQTLWFGDGCLIFGTAVHEIMHSLGLF
HTHSRFDRDNFLSVSYKDVPENMVGNLEKETEQTTYNAVPFEYGSTMLYRYNTFGEGTLV
SKNEDYQKTMGLRRVSFYDLVNINVRYSCGCAKSLTCENGGYTNPSNCATCVCPTGFAGT
LCNEAPSNTIKLTAESYWKGYWVNFGYSTSIQTTNYYLAYLWITAPADKTIEVKIMDLSG
FTCSYGCNYNGVEVKYMGDPRITNPLRCCAQDTEYLNQVISSKQNPTPIVMQQRYGSSKL
TIHYRYVDTPLSSNKKSTNGYDNYQYYV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatatcaactgtataaaacaatggaagatgtcaaagaaaatcacttcgacatg
tttcttcgaccatctaccttacttctaactttattcttggcattggttgctggatcagcg
atccgaaaagatgtggacgagtttgattcaaataaaggaaaagatggtattgtagatgga
gacattatgcttactgaagctcagcttcgaattctcaatggaaccgcaaaacgttcaaaa
aggcagatcacaaagatttggaaaaaatggccagatgcaaaagtattttattactacgaa
aatgaattcacaagtcttaaacgagaattgatgtcatatgcgatggcccatatcagttcg
aacacttgtgtcaaattccaagaaagtaattcagcaacgaacagaattcgttttacaaat
acaggaggatgtgcttcctatattggaatgaatggaggagaacaaaccttgtggttcgga
gatggatgtcttatctttggtactgctgttcacgaaatcatgcactctcttggactgttc
cacacgcactctcgttttgatcgtgataacttcctgtcggtcagctacaaagatgttcct
gaaaatatggttggaaacttggaaaaagaaactgaacaaacgacgtacaatgctgtacct
ttcgaatatggaagcactatgttgtacagatacaacaccttcggagagggaacccttgtt
tcaaagaacgaagattatcagaaaacaatgggattgcgtcgagtgtcattctacgatttg
gtcaatataaacgttcgatattcttgcggttgtgctaagagtttgacatgtgagaatggt
ggatatacaaatccatccaattgtgctacttgtgtctgcccgactggatttgctggaact
ctttgcaacgaagcaccaagtaatactatcaagctcaccgcagaatcttattggaaagga
tattgggttaattttgggtacagtacctcaattcaaactaccaactattacttggcttac
ttgtggatcactgcgccagctgacaaaacgattgaggttaagataatggatctctcaggt
ttcacatgctcttacggatgcaattacaatggagtggaggttaaatatatgggtgatccg
agaattaccaatccactacgatgctgtgcccaagacactgaatatctgaaccaagtcatt
tccagcaaacaaaatccaacaccaattgttatgcaacagagatacggaagcagcaagttg
acaattcattacagatacgttgatactccattgagcagcaataagaagtcaactaatgga
tatgataattatcagtattacgtctaa

DBGET integrated database retrieval system