KEGG   Caenorhabditis elegans (nematode): CELE_K03B8.3Help
Entry
CELE_K03B8.3      CDS       T00019                                 

Gene name
nas-18
Definition
Protein NAS-18
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_K03B8.3 (nas-18)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_K03B8.3 (nas-18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(11395811..11395940,11396186..11396356,11396414..11396598,11396997..11397401,11397493..11397650,11397698..11397881)
Genome map
AA seq 410 aa AA seqDB search
MCASCLHNANAASFLMETFSRHRLNFICIGKMNIFYNVTSLDNKYSFHNPSAPVPHSSHA
LSSRQAHFTSFRAPVAPPSRPRRSQLPSSAKLLYCFDSSFSTEKRELMLFSMNFISSQTC
VTFEENCSIPNRVQLVNGKGCSSYIGMNNIVQHLTFNDTCIDFGTAVHELMHALGVIHTH
SRLDRDNFLNINLTNVSKEMMHNYAIFNQSTNVVPYEYGSTMHYYANISTMFPKKSEYSA
TLGIGRVTFYDMVILNTAYNCKCPNELLCGNGGYTNPSKCSECICPLGYGGVLCDRPSLI
GKDTGLPLEVKDKIIEVKVVGIDNFFSYPTCLINGLEIKYMGDPRITNPIYCSADLINGK
SFRSKLNPLLMNIHTLFGKNKVTFHYRYVTERLSGYNKTTNGYDNYEYYD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcatcgtgcctccacaatgccaatgctgcgagtttcctaatggagacattctca
agacatcgccttaactttatctgcataggtaaaatgaacatattttataacgtaacatca
ttagataacaaatactcttttcacaatccgagcgcgcctgttccgcactccagtcacgcc
ctatcctcgcgccaggcgcatttcacctcttttcgcgcgccagtcgcacccccttcgcgc
cccaggaggagccaactaccgagtagtgcaaaattattatattgctttgattcttcattc
agtactgaaaagcgagaattgatgcttttctccatgaacttcatatcttcacaaacttgc
gtgacttttgaagaaaactgttcaattcctaacagggtccaacttgttaacggtaaaggc
tgttcatcatacattgggatgaataacatagtacaacatctaacatttaacgatacgtgc
atagactttggaactgctgttcatgaattaatgcatgcattaggtgttattcacacccac
tctagacttgatcgagataactttttaaacattaatctgacaaatgtgtccaaggaaatg
atgcataattatgcaattttcaaccaatctacaaacgttgtaccttatgaatacggaagc
actatgcattactatgcgaatatatcgacaatgtttcccaagaagtcagaatactctgcc
acacttggaataggaagagtcacgttttatgatatggtaattttaaatactgcatacaac
tgcaaatgtccaaatgaattattgtgtggaaatggaggatacacaaatccgtcgaaatgc
tcggaatgcatttgtccgttgggatatggtggagtcttgtgtgatcgtccaagtcttatt
ggaaaggatactggattgccattggaagtaaaagataaaattattgaagtgaaagttgtg
ggaatagataatttctttagttaccctacctgtcttattaatggattggagatcaaatat
atgggggatcccagaatcacaaatccaatttattgttcggctgatttaatcaatgggaaa
tcgttcagatcaaaattgaatccgcttcttatgaatattcacacactttttgggaaaaac
aaagtgactttccattacagatatgtgactgaacgcttgagtggctacaataaaacaacc
aatggatatgataactatgagtattatgattaa

DBGET integrated database retrieval system