KEGG   Caenorhabditis elegans (nematode): CELE_K03D10.3Help
Entry
CELE_K03D10.3     CDS       T00019                                 

Gene name
mys-2
Definition
Protein MYS-2
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CELE_K03D10.3 (mys-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(14118758..14118913,14119037..14119203,14119947..14120169,14121248..14121412,14122009..14122095,14123094..14123243,14123299..14123428,14124918..14125145,14126339..14126602,14126767..14126849)
Genome map
AA seq 550 aa AA seqDB search
MSKREPRKRAHDSTNEAAAPGGNDSEPPQQQIMPIINKRYMVEKFIINTVKKVVAVIIHI
DFRKPPQEVRTNNYKSIENHEQGAKELMYYVHYEELDRRNDEWITLDKILVNEVVVEPVI
KVPTKAPVEDLHKEIVVGPPVIKPSGALTRSQRRTLEEYSHLKTDLNDLDATTARLEREH
EERTKVKNIPQITIGAHEILAWYYSPFPPDCENLDIYMCEYCLLYTPHHERFKQHIDTCK
VRQPPGNEIYRKDHLSVYEVDGSGQKLFQPFFAPFPPKLPIFQLYCQCLCLLSKLFMDHK
TLYFDVDDFMFYVLCETDEHGAHIVGYFSREVESANNLACIMVFPPFQKKGYGKLLIQFS
YELSRREGYIGMPEKPLSDLGKVSYRSYWWWRLMKLFHIHQGHTVTATFLSNESGIAVDD
IVSTLITMRMCRQYKEPEFIPGEWYVRIHRKIVDHCVMCGYGKPPRLLLDRTKVRWAPAQ
TRPEFERQQQRTAAAMTSRRASKSQNVTPLVTPLATPPIEQKPEDTYTPSPLTDHHVATD
APDHISLPLN
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgagagccgaggaaacgagcacacgactcaacaaatgaggcagctgctccc
ggcggaaatgacagtgaacccccgcaacaacaaataatgccaataattaacaaacgatat
atggtcgagaaattcattattaatactgtgaaaaaggtggtcgccgtaattatacacatt
gattttcgaaaaccgccgcaagaagtccgcacgaataactataaatccattgagaatcac
gagcaaggagcgaaagagctcatgtattatgtgcattatgaggagttggatcggaggaat
gatgaatggattacgctggacaaaattctcgtaaacgaagtggtagtcgagccggtgatc
aaagtgcccacaaaagcgcctgtcgaagatctacacaaggaaattgtcgtcggaccgccc
gtcataaagccatctggagccctaacacgaagtcagcggaggacattggaagaatattca
catttaaaaacggatcttaatgatttggacgccacgaccgcccggctagaacgggaacat
gaagaacgtacaaaagtgaagaacataccacaaataacgataggcgctcacgagattctc
gcctggtactattcaccgtttccgcctgactgtgaaaatttggacatttatatgtgtgaa
tattgcctactctacacacctcatcacgaacgattcaagcagcacattgatacgtgcaaa
gtgcgtcaacctcccggaaatgaaatctaccgaaaagatcatctatcagtgtacgaagtg
gacggaagtggacagaagctttttcagccattttttgcccctttccccccaaaattgccc
atttttcagctctactgtcagtgcttatgcctactttccaaacttttcatggatcacaag
acgctctactttgacgtcgatgatttcatgttttatgtgctttgcgagacagacgagcac
ggagcccatatagttggctacttttcacgagaagtcgaatcggcaaataatttggcgtgt
ataatggtttttccgccgtttcagaagaagggatacggaaaattgttgattcagtttagt
tacgagctatcccgccgcgaaggatacattggaatgcccgaaaaaccgttgtcagacctc
ggaaaagtgtcatatcgcagctattggtggtggcgactgatgaaattgtttcatatacac
cagggacatacagtaaccgccacgtttttgtcgaatgagtcgggcatcgccgtcgatgat
attgtttcgacgttgattacgatgcgcatgtgccgacagtataaggaacccgaattcatt
cccggcgagtggtacgtacgaattcatcgaaaaatagtggatcattgtgtaatgtgtggc
tatggtaaaccgccaaggctcctactcgaccggaccaaagtccgctgggctccggcccaa
actcggcccgaattcgaacgacaacagcaacggacggccgcagcgatgacgtcacgcagg
gcctcgaaatcgcaaaacgtcacacccctggtcacgcccctagccacgcccccaattgag
cagaagcctgaagacacctacaccccgtcgccgctgacagaccaccatgtagctacggat
gctcccgaccatatctcattgccattgaactga

DBGET integrated database retrieval system