KEGG   Caenorhabditis elegans (nematode): CELE_K03D10.3Help
Entry
CELE_K03D10.3     CDS       T00019                                 

Gene name
mys-2
Definition
(RefSeq) Histone acetyltransferase
  KO
K11308  histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CELE_K03D10.3 (mys-2)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CELE_K03D10.3 (mys-2)
   HAT complexes
    NSL complex
     CELE_K03D10.3 (mys-2)
    MSL complex
     CELE_K03D10.3 (mys-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_7 Acetyltransf_1 DASH_Dad3 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 173281
NCBI-ProteinID: NP_001309531
WormBase: WBGene00010537
UniProt: A0A131MAV3
Position
I:join(14118758..14118913,14119037..14119203,14119947..14120169,14121248..14121412,14122009..14122095,14123145..14123243,14123299..14123428,14124918..14125145,14126339..14126602,14126767..14126849)
Genome map
AA seq 533 aa AA seqDB search
MSKREPRKRAHDSTNEAAAPGGNDSEPPQQQIMPIINKRYMVEKFIINTVKKVVAVIIHI
DFRKPPQEVRTNNYKSIENHEQGAKELMYYVHYEELDRRNDEWITLDKILVNEVVVEPVI
KVPTKAPVEDLHKEIVVGPPVIKPSGALTRSQRRTLEEYSHLKTDLNDLDATTARLEREH
EERTKVKNIPQITIGAHEILAWYYSPFPPDCENLDIYMCEYCLLYTPHHERFKQHIDTCK
VRQPPGNEIYRKDHLSVYEVDGSGQKLYCQCLCLLSKLFMDHKTLYFDVDDFMFYVLCET
DEHGAHIVGYFSREVESANNLACIMVFPPFQKKGYGKLLIQFSYELSRREGYIGMPEKPL
SDLGKVSYRSYWWWRLMKLFHIHQGHTVTATFLSNESGIAVDDIVSTLITMRMCRQYKEP
EFIPGEWYVRIHRKIVDHCVMCGYGKPPRLLLDRTKVRWAPAQTRPEFERQQQRTAAAMT
SRRASKSQNVTPLVTPLATPPIEQKPEDTYTPSPLTDHHVATDAPDHISLPLN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgagagccgaggaaacgagcacacgactcaacaaatgaggcagctgctccc
ggcggaaatgacagtgaacccccgcaacaacaaataatgccaataattaacaaacgatat
atggtcgagaaattcattattaatactgtgaaaaaggtggtcgccgtaattatacacatt
gattttcgaaaaccgccgcaagaagtccgcacgaataactataaatccattgagaatcac
gagcaaggagcgaaagagctcatgtattatgtgcattatgaggagttggatcggaggaat
gatgaatggattacgctggacaaaattctcgtaaacgaagtggtagtcgagccggtgatc
aaagtgcccacaaaagcgcctgtcgaagatctacacaaggaaattgtcgtcggaccgccc
gtcataaagccatctggagccctaacacgaagtcagcggaggacattggaagaatattca
catttaaaaacggatcttaatgatttggacgccacgaccgcccggctagaacgggaacat
gaagaacgtacaaaagtgaagaacataccacaaataacgataggcgctcacgagattctc
gcctggtactattcaccgtttccgcctgactgtgaaaatttggacatttatatgtgtgaa
tattgcctactctacacacctcatcacgaacgattcaagcagcacattgatacgtgcaaa
gtgcgtcaacctcccggaaatgaaatctaccgaaaagatcatctatcagtgtacgaagtg
gacggaagtggacagaagctctactgtcagtgcttatgcctactttccaaacttttcatg
gatcacaagacgctctactttgacgtcgatgatttcatgttttatgtgctttgcgagaca
gacgagcacggagcccatatagttggctacttttcacgagaagtcgaatcggcaaataat
ttggcgtgtataatggtttttccgccgtttcagaagaagggatacggaaaattgttgatt
cagtttagttacgagctatcccgccgcgaaggatacattggaatgcccgaaaaaccgttg
tcagacctcggaaaagtgtcatatcgcagctattggtggtggcgactgatgaaattgttt
catatacaccagggacatacagtaaccgccacgtttttgtcgaatgagtcgggcatcgcc
gtcgatgatattgtttcgacgttgattacgatgcgcatgtgccgacagtataaggaaccc
gaattcattcccggcgagtggtacgtacgaattcatcgaaaaatagtggatcattgtgta
atgtgtggctatggtaaaccgccaaggctcctactcgaccggaccaaagtccgctgggct
ccggcccaaactcggcccgaattcgaacgacaacagcaacggacggccgcagcgatgacg
tcacgcagggcctcgaaatcgcaaaacgtcacacccctggtcacgcccctagccacgccc
ccaattgagcagaagcctgaagacacctacaccccgtcgccgctgacagaccaccatgta
gctacggatgctcccgaccatatctcattgccattgaactga

DBGET integrated database retrieval system