KEGG   Caenorhabditis elegans (nematode): CELE_K03D10.3Help
Entry
CELE_K03D10.3     CDS       T00019                                 

Gene name
mys-2
Definition
Protein MYS-2
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(14118746..14118901,14119025..14119191,14119935..14120157,14121236..14121400,14121997..14122083,14123082..14123231,14123287..14123416,14124906..14125133,14126327..14126590,14126755..14126837)
Genome map
AA seq 550 aa AA seqDB search
MSKREPRKRAHDSTNEAAAPGGNDSEPPQQQIMPIINKRYMVEKFIINTVKKVVAVIIHI
DFRKPPQEVRTNNYKSIENHEQGAKELMYYVHYEELDRRNDEWITLDKILVNEVVVEPVI
KVPTKAPVEDLHKEIVVGPPVIKPSGALTRSQRRTLEEYSHLKTDLNDLDATTARLEREH
EERTKVKNIPQITIGAHEILAWYYSPFPPDCENLDIYMCEYCLLYTPHHERFKQHIDTCK
VRQPPGNEIYRKDHLSVYEVDGSGQKLFQPFFAPFPPKLPIFQLYCQCLCLLSKLFMDHK
TLYFDVDDFMFYVLCETDEHGAHIVGYFSREVESANNLACIMVFPPFQKKGYGKLLIQFS
YELSRREGYIGMPEKPLSDLGKVSYRSYWWWRLMKLFHIHQGHTVTATFLSNESGIAVDD
IVSTLITMRMCRQYKEPEFIPGEWYVRIHRKIVDHCVMCGYGKPPRLLLDRTKVRWAPAQ
TRPEFERQQQRTAAAMTSRRASKSQNVTPLVTPLATPPIEQKPEDTYTPSPLTDHHVATD
APDHISLPLN
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgagagccgaggaaacgagcacacgactcaacaaatgaggcagctgctccc
ggcggaaatgacagtgaacccccgcaacaacaaataatgccaataattaacaaacgatat
atggtcgagaaattcattattaatactgtgaaaaaggtggtcgccgtaattatacacatt
gattttcgaaaaccgccgcaagaagtccgcacgaataactataaatccattgagaatcac
gagcaaggagcgaaagagctcatgtattatgtgcattatgaggagttggatcggaggaat
gatgaatggattacgctggacaaaattctcgtaaacgaagtggtagtcgagccggtgatc
aaagtgcccacaaaagcgcctgtcgaagatctacacaaggaaattgtcgtcggaccgccc
gtcataaagccatctggagccctaacacgaagtcagcggaggacattggaagaatattca
catttaaaaacggatcttaatgatttggacgccacgaccgcccggctagaacgggaacat
gaagaacgtacaaaagtgaagaacataccacaaataacgataggcgctcacgagattctc
gcctggtactattcaccgtttccgcctgactgtgaaaatttggacatttatatgtgtgaa
tattgcctactctacacacctcatcacgaacgattcaagcagcacattgatacgtgcaaa
gtgcgtcaacctcccggaaatgaaatctaccgaaaagatcatctatcagtgtacgaagtg
gacggaagtggacagaagctttttcagccattttttgcccctttccccccaaaattgccc
atttttcagctctactgtcagtgcttatgcctactttccaaacttttcatggatcacaag
acgctctactttgacgtcgatgatttcatgttttatgtgctttgcgagacagacgagcac
ggagcccatatagttggctacttttcacgagaagtcgaatcggcaaataatttggcgtgt
ataatggtttttccgccgtttcagaagaagggatacggaaaattgttgattcagtttagt
tacgagctatcccgccgcgaaggatacattggaatgcccgaaaaaccgttgtcagacctc
ggaaaagtgtcatatcgcagctattggtggtggcgactgatgaaattgtttcatatacac
cagggacatacagtaaccgccacgtttttgtcgaatgagtcgggcatcgccgtcgatgat
attgtttcgacgttgattacgatgcgcatgtgccgacagtataaggaacccgaattcatt
cccggcgagtggtacgtacgaattcatcgaaaaatagtggatcattgtgtaatgtgtggc
tatggtaaaccgccaaggctcctactcgaccggaccaaagtccgctgggctccggcccaa
actcggcccgaattcgaacgacaacagcaacggacggccgcagcgatgacgtcacgcagg
gcctcgaaatcgcaaaacgtcacacccctggtcacgcccctagccacgcccccaattgag
cagaagcctgaagacacctacaccccgtcgccgctgacagaccaccatgtagctacggat
gctcccgaccatatctcattgccattgaactga

DBGET integrated database retrieval system