KEGG   Caenorhabditis elegans (nematode): CELE_K03E6.6Help
Entry
CELE_K03E6.6      CDS       T00019                                 

Gene name
pfn-3
Definition
Protein PFN-3
Orthology
K05759  
profilin
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(1079543..1079640,1079693..1079816,1079863..1079910,1080512..1080622))
Genome map
AA seq 126 aa AA seqDB search
MSWSDIINNNLIGSGNVSKAAILGFDGAVWAKSDNFNISVEEAVAAGKAFTSLDALLGTG
LRLEGQKFLVLNADNDRIIGKQGGSGFFIYKTIQAVIISIYEKGLQPEMCSKTTGALADY
FRSIKY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtctgatattatcaacaataaccttatcgggtctggaaatgtgagcaaggct
gccattcttggattcgacggagctgtatgggcaaagagtgataactttaatatctccgtc
gaagaagccgtcgccgcaggaaaagccttcacctccttggatgctcttcttggaaccggc
ctccgcttggaaggacaaaaattcttggtcctcaacgcagataatgacagaataattgga
aagcaaggaggatctggatttttcatctacaaaactatccaagccgttattatttccatc
tacgagaaaggactccaaccagaaatgtgcagcaagaccaccggagccctggccgattac
ttcaggtccatcaagtactga

DBGET integrated database retrieval system