KEGG   Caenorhabditis elegans (nematode): CELE_K04E7.3Help
Entry
CELE_K04E7.3      CDS       T00019                                 

Gene name
nas-33
Definition
Protein NAS-33
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_K04E7.3 (nas-33)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_K04E7.3 (nas-33)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(6451811..6451914,6451964..6452052,6452099..6452252,6452297..6452441,6452491..6452568,6452975..6453063,6453109..6453228,6453271..6453397,6453443..6453563,6453607..6453689,6453757..6453823,6453878..6453992,6454037..6454157,6454202..6454294,6454338..6454451,6454494..6454577,6454619..6454712,6454866..6454920,6455053..6455134))
Genome map
AA seq 644 aa AA seqDB search
MLFVSILISQFVTCLTQPDFFERPPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWD
RPPPPWRRPPWHRRPPWGLPPPPPPPEPEPQQDQPQVMFSQDIDKVVNSVNQNTAAFQRP
GESYDKVIQIMSSYFNRKSGSQYDINTVIPSSGIYNNEMAANSKIAAVMFESDMALTVSQ
MNKVAQNGFRVKRKMNLNGTTWSRNIPYRFLDTDGNWQSQITNGLRHYERNTCIRFSLNG
GGSDYLVFSKGEGCYSSVGRLGGPQEISIGDGCETLGIITHEVGHALGFWHEQARPERDS
YVRINRQNAINGLEGQFDKRSWSEVNEYSLPYDYGSVMHYGPKSFSKSSTMNTVEPVDPA
FINTIGNRVEPSFLDLKLLNTAFCSNICTNRINCQHGGYADPNNCGQCTCPTGLEGTYCE
RLQTSNCGVELPRADYSWRNISYSGSSDCYWRIVSANGGNVRFELTYVMYRCSPVCEEFV
EMKAEYSHEATGYRQCCKAVLGERISKGNSVLIISKATQNSQFVLRYREDGTAPTQRPPP
VRVAAPRSYSLLWSGWTRCSENCGSCGTQYRERCTSTTNCLRSAKQTRVCNTQPCAQGTT
RGKRSVLQTQISHRVKRLNGWCCARFVLSRGVCVPVRTGVTHPN
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttatttgtaagcatactgatatcacagtttgttacttgtctgacgcaacctgatttt
tttgaacggcctcctcctccagattggttttttccaggacctcttcggccttggggaccg
cctccaccttggcatcgaaaccgaggtcctccgccattcggacccccacctccatgggat
cgaccaccgccaccttggcgaagacctccatggcatagaagacctccatggggtctcccg
ccaccgcctcctccgcctgagccggaaccacaacaagatcagccgcaagttatgtttagt
caggatatagacaaggttgtcaatagtgtgaaccagaatacagctgcgttccagcgcccc
ggagaaagttatgataaagttatccagattatgagttcttattttaatcgaaaatcagga
tctcaatatgatataaacactgtaatcccgtccagtgggatttacaacaatgaaatggct
gcaaatagcaaaattgctgcagttatgtttgaaagtgatatggctttaacggtttcacaa
atgaataaagtagctcaaaacggctttcgtgtgaaacgaaaaatgaatttgaacggaaca
acgtggtctcgaaacattccttatcgttttttagatactgatggtaactggcaatctcaa
ataacaaacggtttaagacactatgaaagaaacacttgcatacgtttttctctcaatgga
ggtggctcggattacctggtttttagcaaaggagaaggatgctattctagtgttggcaga
ttgggaggccctcaggaaatttctattggtgatggatgtgaaacgctcggaattattact
catgaagtgggtcatgctttaggattttggcatgaacaagcgagacctgaacgagattca
tacgttagaatcaatcgccaaaatgctataaatggtcttgaaggccaattcgacaagaga
tcgtggtcggaagttaacgaatacagcttaccttatgattatggatcggttatgcattac
ggaccaaaatctttttccaaatcttcaacaatgaacaccgttgaaccagtagatcctgca
ttcattaacactattggaaacagagtggaaccttcattccttgatcttaagttgctcaat
acggctttctgttctaacatttgcaccaatcggataaactgccaacacggcggttacgcg
gatcccaacaattgtgggcaatgtacgtgtccgacaggactggaaggaacatattgtgaa
cgactgcaaacttctaattgcggtgtggaacttccacgggcagattactcatggagaaat
atttcctattcgggatcatctgactgttattggagaattgtttcggcaaacggcggcaat
gtacgttttgagctcacctatgtgatgtatagatgttctccagtatgtgaagagtttgtt
gagatgaaagcagaatatagtcatgaagcaaccggataccggcagtgttgcaaagccgtc
cttggtgaacgaattagcaaaggaaacagtgttctgattatttcaaaagctactcagaac
tcacaatttgtactcagatatagagaagatggtacagctcccactcaaagaccaccccct
gtcagggttgctgctccaagaagttattctttactgtggtccggttggacaagatgctct
gaaaattgtggttcttgtggtactcagtatagagaaagatgtacaagtacaacgaattgc
ttaagatcagctaaacaaacaagagtctgtaatactcagccatgtgcacaaggaaccacc
aggggaaaacgcagtgttcttcaaactcagatctcacatcgtgtaaaacgtctcaatggg
tggtgttgtgccagatttgttctttcaagaggtgtctgtgttccagtgagaacaggggtg
acgcatccgaactga

DBGET integrated database retrieval system