KEGG   Caenorhabditis elegans (nematode): CELE_K04G2.5Help
Entry
CELE_K04G2.5      CDS       T00019                                 

Gene name
ath-1
Definition
(RefSeq) Acyl protein THioesterase family
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_K04G2.5 (ath-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CELE_K04G2.5 (ath-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 DLH Abhydrolase_1 Esterase FSH1 Abhydrolase_6 Abhydrolase_3 DUF2974 Abhydrolase_5 Esterase_phd Lipase_3 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 172587
NCBI-ProteinID: NP_001293296
WormBase: WBGene00010564
Ensembl: WBGene00010564
UniProt: A0A061ACY0
Position
I:complement(join(8037184..8037231,8037888..8038052,8038100..8038394,8038676..8038910,8039068..8039181,8039695..8039752))
Genome map
AA seq 304 aa AA seqDB search
MFRSVSRSAISTSRCVFLSGLFSRVIVTSAVSTQTVHPFSSNSTFSSSPKTFLASIIGSS
LSSRLLCSLGGPPSDEEDSTRMSAVSNGNPSIVSPRGEHKGTLIFLHGLGDQGHGWADAF
KTEAKHDNIKFICPHSSERPVTLNMGMRMPAWFDLFGLDPNAQEDEQGINRATQYVHQLI
DAEVAAGIPASRIAVGGFSMGGALAIYAGLTYPQKLGGIVGLSSFFLQRTKFPGSFTANN
ATPIFLGHGTDDFLVPLQFGQMSEQYIKKFNPKVELHTYRGMQHSSCGEEMRDVKTFLSA
HIAH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcagcgtgtctagaagcgccatttccactagccgttgcgtctttttatcaggc
ctcttctcacgagttattgtaacttctgccgtctctacacagactgtccaccccttctcg
tcaaattccacattttcttcttcaccaaaaacttttctagcttcaataatagggtcatca
ctttcttcccgtcttctctgttcacttggtggaccgccatccgacgaagaagattcgaca
agaatgtctgcagtctccaacggaaatccttcgattgtgtcgccacgtggcgagcataaa
ggaacattaatcttccttcatggactcggtgatcaagggcatggttgggcagatgctttc
aagacagaagccaaacacgataatatcaagtttatctgtccacacagctctgaacgtcca
gtaaccctcaatatgggaatgcgaatgccagcttggttcgacttatttggcctcgatcca
aatgctcaggaagatgagcaaggaattaatcgagctacccaatatgttcatcaattgatt
gatgcggaagttgcagctggaattccagcttctcgaattgctgtcggtggattttcaatg
ggtggagctctcgctatttacgctggtctcacatatccacagaaacttggaggaattgtt
ggactcagttcattctttttgcagagaaccaaattcccagggagcttcactgcgaacaat
gctacaccaatcttcctcggacatggaacagacgactttttggttcctcttcaattcgga
caaatgtccgagcagtatattaaaaaattcaatccgaaagttgagcttcacacctacagg
ggaatgcagcattcgagctgtggagaggagatgcgtgatgtgaagaccttcttgagcgcc
cacattgcccactaa

DBGET integrated database retrieval system