KEGG   Caenorhabditis elegans (nematode): CELE_K06A4.1Help
Entry
CELE_K06A4.1      CDS       T00019                                 

Gene name
nas-3
Definition
Protein NAS-3
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(9478189..9478278,9478334..9478446,9478550..9479150,9479312..9479386)
Genome map
AA seq 292 aa AA seqDB search
MYRFIIFFSLLALTASKVSEPEKDDEIAVKIPTKRSVSEPPKDDDIAVKIPMRKKRGIAI
HPWQWESHLWPNAEVPYDIASHYTATERGIILSAMEAFRDVTCVRFRPRRSTDKHYLQIN
KHYQLERCFSYIGRQSSRWLFGTRDGKVETRMKLDPSCLLYNGRGTVMHELMHILGFYHE
HQRDDRDRRIGGSASHYNFKIYQRAKSYYMGGYDANSIMHYNFGSVPWQKRDYFSPSDIR
NINTLYKCNNRVVSKFPSTIPSTSTTTTKAPQFELFEKKQIESNSLFRRRRS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgatttattattttcttctccttactagcattgacagcttcaaaagtttccgaa
cctgaaaaagacgatgaaatcgccgtgaagattccaacaaaacggtcagtctccgaacca
ccaaaggatgacgatatcgccgtcaagatcccaatgaggaagaaacgcggaattgctatt
cacccatggcaatgggaatcacatctctggccaaacgctgaagtaccttatgatattgct
tctcactacactgcaactgaaagaggaataattctatctgcaatggaagcattcagagat
gtcacttgtgttcggttccgtccacgtcgttctactgataagcattatctccaaataaac
aagcattatcagctcgaacgatgcttctcctatattggtcgtcaaagcagtcgctggctc
ttcggaactcgtgatggaaaagttgaaacccgcatgaagcttgatccttcctgccttctc
tacaatggacggggaactgtaatgcatgagttgatgcacattctcggattctaccacgag
catcagagagacgatcgtgaccgccgtattggaggatcagcatctcattacaacttcaag
atctatcaacgtgccaagtcgtactacatgggcggttacgatgccaattcgattatgcac
tacaactttggaagtgtaccatggcaaaagagagattacttctctccatctgatattcgt
aacatcaatactctctacaagtgcaacaatcgggtggtcagcaaatttccctcaactatt
ccatctacttctacgacaactacgaaagcgccgcaattcgaattgttcgaaaagaagcaa
atcgagtcgaacagtttgtttcgtagaagacgttcctaa

DBGET integrated database retrieval system