KEGG   Caenorhabditis elegans (nematode): CELE_K07C11.2Help
Entry
CELE_K07C11.2     CDS       T00019                                 

Gene name
air-1
Definition
Protein AIR-1
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_K07C11.2 (air-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   CELE_K07C11.2 (air-1)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CELE_K07C11.2 (air-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(8221501..8221551,8221596..8221657,8221703..8221888,8221942..8222085,8222130..8222238,8222514..8222741,8223038..8223238)
Genome map
AA seq 326 aa AA seqDB search
MSGKENTAPVIDDQKAEVISLTEDSRPQRVDQAREESCWSLDDFDVGRPLGKGKFGNVFI
SREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVI
LDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSK
LNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYA
PFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMK
QREDIEVPLFISTLTKSSRNNSTANQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaaggaaaatactgctcctgtgatagacgatcagaaggccgaggttatttca
cttacggaagatagcagacctcagagagttgaccaggcaagggaagaatcatgctggagt
cttgatgattttgacgttggacggcctctcggaaaaggaaagtttggaaacgttttcatc
tctcgtgaaaaaaagaccaagcgaatcatagctttgaaagtactcttcaaaacacagttg
cttcaacttggagtcagtcatcagttgaagagagagatcgaaattcaatatcatttgcgt
catccgaatattctcactctttatggatactttcacgatgacaagcgtgtgttcgtcatt
ctcgactatgccagcagaggagaattatttaatgtcctccaatcacaacctggacacaaa
gtgaatgaggtcattgccggaagatttgtgcgacagctggccaatgcgttgcattactgc
cattcgaaaggagttattcacagagacattaagcctgaaaatcttcttcttgattcgaag
ctcaatctgaagcttgccgatttcggatggtccgtcgttgctgatcactcgaaacgccat
acattgtgcggtaccatggattatcttgctccggaaatggtttccaatcagccacatgac
tttaatgttgacatttgggcaattggaattcttctcttcgaaatgcttgttggatatgct
ccgttcgccaatcaaactggtgataaattgatcgccagaatcaaggagtgcaagatttat
attccaagtgttgtgactgacggagctgccagtttgataaatgcaataatcaaaaaggaa
ccccaagaacgtctcccacttgttgacatcatggctcatccgtggattaaggaaatgaag
caacgcgaagacattgaagttccactcttcatttcgacgctcacgaaatccagtcgcaat
aattctacagccaatcaataa

DBGET integrated database retrieval system