KEGG   Caenorhabditis elegans (nematode): CELE_K07C11.2Help
Entry
CELE_K07C11.2     CDS       T00019                                 

Gene name
air-1
Definition
Protein AIR-1
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(8221481..8221531,8221576..8221637,8221683..8221868,8221922..8222065,8222110..8222218,8222494..8222721,8223018..8223218)
Genome map
AA seq 326 aa AA seqDB search
MSGKENTAPVIDDQKAEVISLTEDSRPQRVDQAREESCWSLDDFDVGRPLGKGKFGNVFI
SREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVI
LDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSK
LNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYA
PFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMK
QREDIEVPLFISTLTKSSRNNSTANQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaaggaaaatactgctcctgtgatagacgatcagaaggccgaggttatttca
cttacggaagatagcagacctcagagagttgaccaggcaagggaagaatcatgctggagt
cttgatgattttgacgttggacggcctctcggaaaaggaaagtttggaaacgttttcatc
tctcgtgaaaaaaagaccaagcgaatcatagctttgaaagtactcttcaaaacacagttg
cttcaacttggagtcagtcatcagttgaagagagagatcgaaattcaatatcatttgcgt
catccgaatattctcactctttatggatactttcacgatgacaagcgtgtgttcgtcatt
ctcgactatgccagcagaggagaattatttaatgtcctccaatcacaacctggacacaaa
gtgaatgaggtcattgccggaagatttgtgcgacagctggccaatgcgttgcattactgc
cattcgaaaggagttattcacagagacattaagcctgaaaatcttcttcttgattcgaag
ctcaatctgaagcttgccgatttcggatggtccgtcgttgctgatcactcgaaacgccat
acattgtgcggtaccatggattatcttgctccggaaatggtttccaatcagccacatgac
tttaatgttgacatttgggcaattggaattcttctcttcgaaatgcttgttggatatgct
ccgttcgccaatcaaactggtgataaattgatcgccagaatcaaggagtgcaagatttat
attccaagtgttgtgactgacggagctgccagtttgataaatgcaataatcaaaaaggaa
ccccaagaacgtctcccacttgttgacatcatggctcatccgtggattaaggaaatgaag
caacgcgaagacattgaagttccactcttcatttcgacgctcacgaaatccagtcgcaat
aattctacagccaatcaataa

DBGET integrated database retrieval system