KEGG   Caenorhabditis elegans (nematode): CELE_K08A8.1Help
Entry
CELE_K08A8.1      CDS       T00019                                 

Gene name
mek-1
Definition
Protein MEK-1, isoform B
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_K08A8.1 (mek-1)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_K08A8.1 (mek-1)
   04012 ErbB signaling pathway
    CELE_K08A8.1 (mek-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_K08A8.1 (mek-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CELE_K08A8.1 (mek-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(7479256..7479439,7479489..7479721,7479772..7479915,7479971..7480312)
Genome map
AA seq 300 aa AA seqDB search
MERDFDLGMGRPGGLGGLGGEPIMQQMPQPAPHHPSRSSNDHNVKNLMKQAEENSGYLTL
QGNRRKADLKELQFVEDIGHGSCGTVTKCRYKSVIMAVKTMPRTSNSYEMSRILMDLDVI
CLSFDCPYIVRCFGYFITNFDVRVCMECMATCLDRLLIRIKQPIPERIIGKLSVSIIKAL
HYLKTKHQIMHRDVKPSNILLDWSGVIKLCDFGIAGRLIESRAHSKQAGCPLYMGPERLD
PNNFDSYDIRSDVWSFGVTLVELATGQYPYAGTEFDMMSKILNDEPPRLDPVCALRKKFI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggagagagacttcgaccttggcatgggcagacctggcgggctcggaggacttggtggt
gaaccgatcatgcaacaaatgccacagccagcgcctcatcatccatcccgtagtagtaac
gaccacaatgtgaagaacctcatgaagcaggccgaggagaactccggatatctcacattg
caaggtaaccgtcgtaaagctgacttgaaggagcttcagttcgtggaagatattggtcat
ggaagctgcggtacggtcacaaagtgcagatacaagagtgtgatcatggctgtgaagacg
atgcctcggacgtcaaacagttatgaaatgtcccgcattttgatggatcttgacgtcatc
tgtctctctttcgactgtccgtacattgtacgttgcttcggatacttcatcaccaacttc
gacgtccgtgtctgcatggagtgcatggctacttgccttgaccgtctgcttatccgcatc
aagcagccaattccagagagaattattggaaagttgagtgtgagcatcattaaagctctg
cactacttgaaaaccaagcaccaaatcatgcaccgtgatgtgaagccatcaaacattctc
ctcgactggagtggcgtcatcaagctttgcgatttcggtattgctggcagactgatcgag
tctcgtgctcattcgaagcaagccggatgccctctgtacatgggtcctgagcgcctcgac
cccaacaactttgactcgtatgacattcgcagtgacgtgtggtcttttggtgttactttg
gtcgagctggcaaccggacagtacccatacgccggaaccgaattcgacatgatgtccaag
attctcaatgacgagccaccgcgcctggatccggtatgtgctcttcgtaaaaaattcatc
tag

DBGET integrated database retrieval system