KEGG   Caenorhabditis elegans (nematode): CELE_K08E3.5Help
Entry
CELE_K08E3.5      CDS       T00019                                 

Gene name
K08E3.5
Definition
Protein K08E3.5, isoform C
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cel00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cel00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cel00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cel00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(13764188..13764295,13764343..13765212,13765334..13765438,13765485..13765652,13765701..13765925,13767924..13767983))
Genome map
AA seq 511 aa AA seqDB search
MAQRHVSVGCFSTFSEAEAKSSEEWKTSTKLEALGSMEGELAHLLSTCKPETLNHNKTEL
SGFRNLFARFLRAKPTVDWSKIEPLPEGAIRPYKSLGHVVDKELIASQLRKLVVVKLNGG
LGTSMGCKGPKSVISVRNDLTFLDLTMQQIQTLNKTYGVDVPLVLMNSFNTNEDTQKVLK
KYANVKVSVHTFSQSQYPRINRETLLPIVKSLEADDNECWYPPGHGNFYEAFHNSGLLDK
FLADGKEYCFLSNIDNMGATVDLSILNFVLNPSPDQTAPEFLMEVTDKTRADVKGGTLIQ
YEGRLMLLEIAQVPKDYVDEFKSISKFRIFNTNNLWAKLDAMRKIVVENKLEMEVIVNPK
HLDRGLDVIQLETAAGAAIKSFSGAVGVNVPRSRFLPVKKTSDLLLLMSNLYDIDNGSLT
LSHQRSFPTTPLVKLGSSFDKVKDYLGRFNGIPDLLELDHLTVSGDVWFGKDVSLKGTVI
IIANHGDRIDIPPGSILENKIVSGNLRILEH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcgacacgtcagcgtgggatgcttttcgacgttcagcgaggctgaggcgaag
agctccgaagaatggaagacctcaacgaagcttgaggctcttggatcgatggagggagag
ttggctcacctgctttcaacctgcaaacctgagacgttgaatcacaacaagacagagcta
tcgggcttccgcaatctcttcgctcgctttcttcgtgccaagcccaccgtcgattggtcc
aagattgagcctcttccagagggagccatccgtccgtacaaaagtctcggtcatgtcgtc
gacaaggaacttatcgcttcgcaacttcgcaagttggtcgtggtgaagctcaacggaggt
ctcgggacatcaatggggtgcaagggaccaaagtcggtaatttctgtccgtaacgatctg
accttccttgacttgaccatgcaacaaattcagactttaaacaaaacctatggggtcgac
gttcccctcgtgctcatgaactcgttcaatacaaacgaggacactcagaaagtgctcaaa
aagtatgccaacgttaaggtctccgtgcataccttctcccaatctcaatacccacgtatc
aaccgtgagactcttcttccaatcgtcaaatcactcgaagccgacgacaacgaatgctgg
tacccaccaggtcacggaaacttctacgaggccttccacaactctggactcctggacaag
ttcctcgccgacggcaaagaatactgtttcctatccaacattgacaatatgggagctacc
gtggatctttctattctcaattttgtgctgaacccatctcccgatcaaactgctccggag
ttcttgatggaggtcaccgataagacccgtgctgacgtgaagggaggaactctcattcag
tacgaaggacgtcttatgcttcttgaaattgctcaggtgccgaaggattatgtggacgag
ttcaagtcgattagcaaattccgaattttcaatactaacaacttgtgggccaagcttgac
gccatgagaaaaattgtggtggaaaacaagctcgaaatggaggttatcgtcaatccgaag
catctcgaccgtgggcttgatgttattcaactcgaaaccgccgctggtgcagccatcaag
tcattctctggagctgttggagtcaatgtgccacgttcccgtttcttgccagtcaagaag
acttctgatcttctgcttttaatgtcaaatctttacgatattgacaatggatccttgacg
ctgtctcatcaaagatccttcccaacaacaccgctggtgaagctcggatcttcattcgat
aaggtcaaggactacctgggacggttcaatggaatccctgatcttctcgagctggatcac
ttgacagtttctggtgatgtctggttcggaaaggatgtatctttgaagggcaccgtcatc
atcattgccaaccacggagatcgtatcgatatcccgcctggttcgattctggagaacaag
attgtttctggaaatttgcgcattttggagcactaa

DBGET integrated database retrieval system