KEGG   Caenorhabditis elegans (nematode): CELE_K09C8.3Help
Entry
CELE_K09C8.3      CDS       T00019                                 

Gene name
nas-10
Definition
Protein NAS-10, isoform A
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_K09C8.3 (nas-10)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_K09C8.3 (nas-10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(10960916..10961031,10961077..10961335,10961562..10961718,10961766..10962115,10962162..10962356,10962553..10962664,10962713..10962799,10962919..10963130,10963182..10963219,10964503..10964659))
Genome map
AA seq 560 aa AA seqDB search
MYTITDLKTINRKQKQAYLQEKLICSRHCWLTHTTSKHINIQWTTLIPHIRCRGFNNGPH
PNSRPGSRPNSPLGDIFGNINGMVKGITDQIGKIAQGLDVNNDLGKMAHGPPPPQSEWVE
HARRFCRRFPGHPKCRGQLPQFNDIGSMLNGILVDSGKWLPKVPFINIRDPLSGINSDLK
NALNGIQVQFGQISQQFANNIRNICQQMNCKQQQQKNVQMKQAILKQTVDFEKKVFGNNV
ADKMNLRFDRTLQLKQALLEKAQLKGVVAPEDNGVFDKDLLLTETQANFMLNELGKGGEG
AIPMPGSAKAKRASIFFEQNLIQKWPSTSPIPYTFDSSLDNLDQNDVRGAISEIEQKTCI
RFKYFASPPKGNHINYQKVNSPSFCGLSYIGRVEPANPVYLSFQCGNGRGIAVHETMHAL
GVNHQHLRMDRDKHIKVDWSNINPQQYDAFVVADSKLYTTYGVKYAYDSIMHYNAYTGAV
NIAKPTMIPLVNQQANIGLLGQRAKMSNADVEILNKMYCKSAGCDDKNVYCGAWALQDLC
NNPNHNVWMRSNCRKSCNFC
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtacactataactgacttaaaaacgataaataggaagcaaaaacaagcctaccttcag
gaaaagctcatttgttctaggcattgttggcttactcatacaacaagtaaacatatcaat
atacaatggactacattaataccccacatacgttgcagaggtttcaacaatggaccacat
cctaactctcggccgggaagtcgaccaaatagcccacttggtgacattttcgggaatata
aatgggatggtaaaaggaataactgatcaaatcgggaaaattgctcaaggacttgatgtg
aacaacgaccttggaaaaatggctcacggtccgccaccgccgcaaagtgaatgggtggaa
catgcaagaaggttttgtagaagatttccaggtcatccaaaatgccgcggacaacttcct
cagtttaatgatattggatcaatgctcaatggtatattagtcgacagtgggaaatggttg
ccaaaagttccatttatcaatatcagagatccattatcaggcattaatagtgatttgaag
aatgccctgaatggaattcaagttcaatttggtcaaataagtcagcaatttgcaaataac
atcagaaatatttgccaacaaatgaactgcaaacaacaacaacaaaagaatgttcaaatg
aaacaggcaatattaaaacagaccgttgatttcgagaaaaaagttttcggaaataacgtg
gctgataaaatgaatttgagattcgatagaactctccaattaaaacaagctcttttggaa
aaggcgcaacttaaaggagtggttgcccccgaggacaacggagtatttgacaaagatctg
ctccttactgaaactcaggcaaactttatgctcaatgagttaggaaaaggcggcgaggga
gcaattccaatgcctggatcagcaaaagcaaaacgtgcatctatatttttcgagcaaaac
ttgatccaaaaatggccaagcacatctccaattccatacacttttgactcatcattggat
aatttagatcaaaatgatgtacgcggagccatttcagaaattgagcaaaagacatgcatt
cgcttcaaatattttgcttctccgccaaaagggaaccacattaactaccagaaagtgaac
tcgccatctttttgcggtttgtcatatattggaagagtcgagccagcaaatccagtgtat
cttagttttcaatgtggaaatggaagagggattgcagttcacgaaacaatgcacgcattg
ggagttaatcatcaacatttaagaatggatagagacaaacatattaaggttgactggagc
aatattaatcctcagcagtacgatgcatttgtggtggccgattccaaactctacactaca
tatggagttaaatacgcgtatgacagcataatgcattacaatgcatacaccggtgccgtg
aacattgccaaaccaactatgatcccattggtcaatcaacaagctaacattggtttactt
ggacagagagccaagatgagcaatgcggatgttgagattcttaataaaatgtactgcaaa
tccgcaggatgtgatgataagaatgtttactgcggagcatgggctcttcaggatctatgt
aacaatccaaatcacaatgtttggatgagaagtaactgtcggaaaagttgcaatttctgt
tga

DBGET integrated database retrieval system