KEGG   Caenorhabditis elegans (nematode): CELE_K10D2.6Help
Entry
CELE_K10D2.6      CDS       T00019                                 

Gene name
emb-8
Definition
Protein EMB-8
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(5196929..5197156,5197201..5197497,5198000..5198248,5198296..5199294,5199348..5199441,5199500..5199621))
Genome map
AA seq 662 aa AA seqDB search
MLAWIVSGLDTSDLVVLTLLAGGAIIFLFMKVFNQQPSSSRYSPTVASVTTSAAASKSNQ
SFIDRMKNENRQVLIMYGSQTGTAEEMSGRLAKDLTRYTKKAVVVDPEDIECEDLNRLSE
VEDALLVLCIATYGEGDPTDNAVTLVEYLNAGDCDLSGVRFAVFGLGNKTYEHFNEIGIQ
MDKQLEKLGAKRIFHLGLGDDDANLEEDFMIWREAFLPKVAEEFGWELNTEAETMRQYQL
EPVEEGKALFKGEFGRLGAYERPRPPFDVKNPYLATVAINDELHTEHSDRSCRHIEFSVE
GSRIRYEAGDHLAVFPTNDPVLVDRLINMLQFDPDHAFRLVNVDEDASKRHPFPCPTTFR
TALSHYVDICAPVKSHVLKAISEYCTDDTEKEFLNKLSTANEEGLKEYARYIVKERRSIV
DVLTDQKTCKPPIEYLLELLPRLQARYYSIASSPRLNEEKIAICAVVTKYSIGDRDINGV
CTRYLTTKDAGSKSPVFVRKSTMRLPHRTTTQVIMIGPGTGFAPFRGFLQDRQFHKNAGK
EIGAMHLYYGCRHPDHDYIYKDELAKFQEDEVLTHLVCAFSRAQEHKIYVQDRLWETRDR
IWDAINVGAHVYICGDARNMARDVQATLQKIFREIGGKSETEAVAYFKDMEKTKRYQADV
WS
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgtggattgtgtcgggtctcgacacatcagaccttgtggtgctcactctgctc
gctggtggagcaattatattccttttcatgaaggttttcaatcagcaaccatcgtctagc
agatactcgccaaccgtagcatcggtcaccacgtcagctgcggcttcgaaatcgaatcaa
tcattcattgatcgaatgaaaaatgagaaccgacaggtgcttatcatgtacggatctcaa
actggaacagctgaagaaatgtctggacgtcttgctaaagatcttactcgttacaccaag
aaggctgttgtcgttgatccagaagatattgaatgtgaagatttgaatcgtttgagtgaa
gttgaggatgctcttttggtactatgcattgccacatatggagaaggagatccaactgat
aatgcagtgacacttgttgaatatttgaatgctggagactgtgatctgtcgggtgttcga
tttgcagtttttggacttggaaataagacttatgaacattttaatgagattggaattcaa
atggacaaacaacttgaaaaacttggagccaagagaatctttcatttgggattaggagat
gatgatgctaatcttgaagaagattttatgatttggagagaagctttcttgccaaaagtt
gctgaagaatttggatgggagttgaacacagaggccgagacaatgagacaatatcaattg
gaaccagttgaagaaggaaaagctcttttcaagggagaatttggacgacttggagcttat
gaacgtccacgtccaccatttgatgtcaaaaatccatatttggctactgttgcgatcaat
gatgaacttcataccgaacattctgatcgtagttgtagacatattgagttctctgttgaa
ggatcccgtattcgttatgaagcaggagatcatctggctgtcttcccaacaaatgatcca
gttcttgttgatcgtctcattaatatgcttcaattcgatcctgatcacgcattccgtctt
gtgaacgttgatgaagatgcatcaaaacgtcatccattcccatgcccaaccacattccga
actgctctttctcattatgttgatatttgtgctccagtcaaatctcatgtgctcaaagca
atcagtgaatattgtacggatgatactgaaaaggaattccttaataagttatcaactgcc
aatgaggagggcttgaaagagtacgccagatacattgtcaaagagcgtcgttcaattgtc
gatgtattgactgatcaaaagacatgtaaaccaccaattgagtatcttcttgaacttctt
ccacgtcttcaagcccgttactacagtattgcttcatctccgagattaaatgaggaaaag
attgcaatttgtgcagttgtcactaaatattctattggtgatcgtgatatcaatggagtt
tgtacaagatatttgaccaccaaggacgccggatcgaaatctccagttttcgttcgtaaa
tcaacaatgcgtcttccccaccgtaccacaactcaagtcattatgattggtcccggaaca
ggattcgctccattccgtggattcctccaagatcgtcaattccacaaaaatgccggaaag
gaaatcggagcaatgcatttgtattatggatgccgtcatccagatcatgattacatctac
aaagatgagttggcaaagttccaagaagacgaagtgctcacacacttggtttgcgctttc
tccagagctcaggaacataagatctacgtgcaagatcgcttgtgggagactcgtgatcgt
atctgggatgctattaacgttggagctcacgtctacatttgtggagacgcccgcaacatg
gctcgtgacgttcaggcaacacttcagaagattttcagagaaatcggaggaaaatctgaa
acggaagctgtcgcctacttcaaagatatggagaagacaaaaagataccaagctgatgtg
tggtcataa

DBGET integrated database retrieval system