KEGG   Caenorhabditis elegans (nematode): CELE_K12D12.2Help
Entry
CELE_K12D12.2     CDS       T00019                                 

Gene name
npp-3
Definition
Protein NPP-3
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cel03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(11865625..11865788,11865844..11866061,11866469..11866608,11866667..11867056,11867120..11867182,11868079..11868168,11869638..11869779,11869841..11870586,11870633..11870937,11871001..11871348,11871784..11871889,11871942..11873536,11873691..11873895,11873945..11874036,11874097..11874448,11874496..11874630))
Genome map
AA seq 1696 aa AA seqDB search
MWIEIRKFYELIVSFTAFDDDRKINELFNEIEKYRWRLSNILLNPRRTGKDREKLKPGNV
EMAGVEVALDEEICSEALILSDIFQLNELEAVDLILAGEAQKIHFEGLNRGLIAVVCYYD
AHRLLIATMRQMLKWDREDIPQRISKFLNSTFINEDVIKNLFQQLINFTVQSEFARLQSP
DVNGLGGSKHQKLVRNAIEEIRSEVIGCISMICEIPGGNAVSISNHLFQIVKAVPPEKLS
CSSLTAWISLVKITSSEVLSQVHDAQQVLTNMIAHIRNETDWSDQAMCGTLQLACAVALK
SIASSPSDHLGIENIKVDVERVIDRSIRNMAFHYLRQAIIKSEHFRYAHQFMIIDELLKQ
LISYFPAKLMETERNSTDELNFLDDQKKEQSTTQKPDPKSQTVHITDKVTAQLSSTDPSN
NYDSALSQYENFLRCFVDLYEMQVTDYAHQKNARTARERELQEQIEENSMAFSTERSIEL
CRLLERARLPNHHVVHSVAYLEMCAAVCKNENTAALLYDIFSKEHCGPDSYGWESLASAL
KGYDRLYREQKYASNSRHNQSQTMSMSTSFHQQQSLNLTLRPGDKITIPAQELSGLVAWI
HMATKVAQLNERAAMRFSDDPSWTLCSVVASLSTSPVPLSMKASMLDLLTAVARLKGSAP
RIWQAIHLNQLCYSSDGGTLMGIQQELEERECVAKQYDVSLAFVKLMTTLLMHRSLPEYA
TPFIQFVTRSILAHFSTRSYNSVVQMWELAEWSLRATNALLEHGIVEPRAVASNEVHIAI
LTQCLNDTPMYRAITRVIMEDCQAHNDPYVTRQSPSSDAALIALRILSRAIILHPALRAC
ARVSSSDIMIASIPSLVFSPIISASACTPLDLVFHYLHMTDDYPVHSLYAARILRDVMAT
RGAAEVKMLELLRSRNSAASHVRAVRAAICATSIQYTIDDSLAKEEDTDNPHFARGETAR
ILIETLSDAIDCQVTRTGNRLTDTNNICYYLLAFRPSKAHTKELYQADDVLTGLHYVLYI
IEQFVMSKKPFDLPFSALLEPAFRLMQRLVSITCPFSKPVLCFMRSSNIIEKLTTSPFIC
SALTLESARDNTYAQGVFAVRRMIVGYILHFAAVEISAMLTTGHFSRPEKLYRALLESSS
LVAEYTQMEEDDDDEDMAPVASGSNDKANLLFSLIRRATVPRKNELLYPNLVHFDVAKLH
ELFDACLTVNIYGVAQYDVLYLNRLLRREIETVYTESGEMKYVQKEMEGVLEYCAEINAS
LLSESASERIVSGCTALLNVFSVFAPVNFFSNKMQIVIFRDACYVLIEMASGVGGSSLVT
ACQTFHRLVLTLTKLAQVEYPRLLDLREFFAPLFKSMIDLFLQPGEKCVDAKVQLYKTMR
FILRTLFEKNSIDTVNEAEEWLLDGLIAPLETPSSDEIVNIVDKMADEIARHLEGSIADL
PKHRKAAGIMLANDLIHEDLKGNKKICNHFSKSGVPRILCEELLHIDFDWNIVTAARKEG
GGGVAGVNQAEHISNYNLFISILTFLTRYGTSESGWHVLAELAVSEILAEMPPFIEPPKE
LFLKPETVKVKGTSAHAYANALDLGLHFCKQMCTKTKWKKQSLKVLAFVQRLGEVFQQLM
RAEIECDCLETAKALVYEISINDEALIGIIDGDQVLRQLKLAEDSKTVKSNARRQFINKG
STFGAPRQLYSTLQPV
NT seq 5091 nt NT seq  +upstreamnt  +downstreamnt
atgtggattgagattcgtaaattttacgaactcatcgtctccttcacagctttcgatgac
gaccgaaaaataaacgagctgttcaacgaaatcgagaaatacagatggcgattgagcaat
attcttttgaatccgagacgaacgggtaaagatcgggaaaagctgaagccaggaaatgtg
gaaatggcaggagtggaagttgcgctagacgaggaaatctgttcggaagcactcattttg
tcggatatctttcaattaaatgagctggaagctgtggatttgattttggccggagaagct
caaaaaatacatttcgaaggcctcaacagaggattaatcgctgtcgtttgctactatgat
gcgcacaggctcctaatcgcaacaatgcgccaaatgctaaaatgggaccgagaggatatt
cctcaacgtatcagcaagttcctcaatagcacattcatcaacgaggacgtgatcaaaaac
ctttttcaacaactaatcaatttcaccgttcaatcagaatttgcacgacttcaatctcca
gatgtcaacggtttaggaggctctaaacatcagaaattggtcagaaatgccattgaggag
attcgaagtgaagtaattggttgcatttcgatgatctgtgagattccgggaggaaacgca
gtttcgatttcaaatcatttattccaaattgtaaaggcagttccaccggagaagctcagt
tgtagtagcttgacagcctggatttctctcgttaaaatcacatcgagtgaagtgttgtct
caagttcacgatgctcaacaagtgctcacaaacatgatcgcccacattcggaatgaaaca
gactggtcggatcaagcaatgtgcggaactctacagctagcatgcgctgttgctctgaaa
tcgattgcctcatcgccatcagatcatctagggatcgagaatatcaaggtggacgtggaa
agagtcatcgatcgatctatccggaatatggcttttcattacttgcgacaagcgatcatc
aagtcggaacacttccgttatgcccatcagtttatgattattgatgagcttctgaaacag
ctgatttcatatttccccgcgaagcttatggagactgaaagaaattctacagacgagctg
aacttcctggatgatcagaaaaaggaacaatcaacgactcaaaaaccggatccgaaaagc
caaacagtccacataacggacaaagttacagctcaactgagctctacagatccatcgaac
aactatgattcggctctatcacaatatgagaacttccttcgatgctttgtggatttatac
gagatgcaagtgaccgactatgcacatcagaagaatgcgagaacagcacgcgaacgagag
cttcaggagcaaatcgaagagaacagcatggcttttagtacggagagatcgattgagctc
tgccggctcctggaacgtgctcgtcttccaaaccatcatgttgttcattcagttgcttat
ctggaaatgtgcgctgctgtatgcaaaaatgagaacacagctgctctactttatgacatc
ttctccaaagaacattgtggaccagattcatatggatgggaatctctggcttcagcactc
aaaggctacgatcgtttgtaccgggagcagaagtatgcgtcgaattctcgtcacaatcaa
agtcagacaatgagtatgagcaccagcttccaccaacaacaaagcctcaatctcacactt
cgtccaggcgacaaaatcaccatcccagctcaagagctcagcggactagtagcctggatc
catatggctacaaaagttgctcaattgaatgaacgagccgctatgcgattctcggatgat
ccttcatggacgttgtgttctgttgtcgcatcgctctccacttctccagtaccgctatct
atgaaagcatcgatgcttgatttgctgacggcagtggcacggctcaaaggatccgcaccg
agaatttggcaagcaattcatctgaatcaattgtgctattcttcggatggtggaacacta
atgggaatccagcaggagctcgaggaacgagaatgtgtcgcgaagcaatatgatgtgtcg
ttagcttttgtgaaattgatgacgacccttctgatgcacagatctctaccggaatacgct
acaccattcatccaattcgtcaccagaagtattttggcacatttctccacacgcagctat
aatagcgttgttcaaatgtgggagctcgccgagtggtcgctccgagccaccaacgcactt
ctcgagcacggaatcgtcgagccgagagccgtggcatcgaacgaagttcatattgccatt
ttgacgcagtgcctcaatgatacgccgatgtacagagctatcacgcgggttattatggag
gattgtcaagctcacaatgatccgtacgtcacacggcagtctccatcatccgatgcagct
ttgattgcactgcgaattttatcacgagcaataattctgcatccggctcttcgtgcgtgt
gcccgtgtctcatccagtgatattatgatcgcttccattccatccctcgtcttctcacca
atcatctcagcctccgcttgcacacctcttgatctcgtcttccattaccttcatatgact
gatgactacccggtacactctctctacgctgccagaattcttcgagacgtgatggctaca
cgtggagctgccgaggtgaagatgctcgagttgttaagatccagaaactcggctgcatct
catgttcgggcggttcgagcggcgatctgcgctacgtcgattcagtatacgattgatgat
tcattggcgaaagaagaagacacagataatccacatttcgcgagaggagaaaccgctcga
attctcatcgaaactctttcggacgccatcgattgccaagtaacaagaaccggaaatcgt
ctgactgataccaacaatatttgctactaccttctcgcattccgaccatcaaaagcccat
accaaggagctgtatcaagcggacgacgtgctcaccggtcttcactatgttctgtatatt
atcgagcaatttgtgatgtcgaagaaaccattcgatttacctttctcagcgctactagag
cctgcattccggctgatgcaaagacttgtctcgatcacgtgcccattctctaaaccagtg
ctctgcttcatgcgatcttcaaatattatcgagaaattgacaacatctccattcatctgt
tcggctctcactctggaaagtgcccgcgacaatacatatgctcaaggtgtattcgctgtt
cgtcgtatgattgttggttacattcttcacttcgccgccgtcgaaatttcggcaatgctc
actactggccacttttctcgacctgagaagctttatcgtgcactcttggaatcatcatct
cttgttgctgaatatactcaaatggaagaagacgacgatgatgaagatatggctccagta
gcttccggaagcaatgacaaggcgaatttgctattctcgttgatccgacgagccacagtg
ccacgaaagaacgagttactttacccgaatctcgtgcatttcgatgtggcaaaacttcac
gaactctttgacgcatgccttacagtgaacatctacggcgttgcacaatatgacgttctc
tacttgaaccgactattacgacgagagattgagacagtctatacggaatcaggcgagatg
aaatatgtacaaaaagagatggaaggagtccttgaatattgtgctgaaattaacgcaagt
ctcttatcggaaagcgccagtgagcgaattgtgtctggatgtactgcgctactcaacgtc
ttctccgttttcgcccccgtcaactttttctccaacaaaatgcaaattgtcatattccgc
gatgcctgctatgtgcttatcgaaatggcatcaggagttggaggaagctccttggtgaca
gcctgtcagacgttccaccgactcgtactgacactcaccaagttggctcaagttgaatat
cctcgacttctcgatcttcgcgaattctttgcaccactgttcaaaagtatgatcgacctg
tttctacagcctggagagaagtgtgttgatgcaaaagttcaactctacaaaacgatgcgc
ttcatcctacgaacattgtttgagaagaatagcattgacacagtaaatgaagctgaagaa
tggcttctcgacggactcatcgcaccactggagaccccatcatcggatgaaattgtcaat
attgtggataagatggccgacgagatagcacgacatctggagggaagtattgccgatcta
ccgaagcataggaaggccgctgggataatgctggccaacgatttgattcatgaggatttg
aagggcaacaagaagatttgcaatcacttttcgaagagtggagtgccgcggattttgtgc
gaggagctgttgcacatcgatttcgactggaatattgtgacagctgcaaggaaggaaggt
ggtggaggtgttgctggggttaatcaagcggagcacatttctaattacaacttgttcatc
tcgattttaacattcctgacgcgctacggaacttcagaatctggatggcacgttcttgcc
gagcttgctgtttcggagatccttgccgagatgcctccgttcattgaaccaccgaaagag
ctctttttgaaacccgaaactgttaaagtaaagggaacctctgcccacgcttatgcaaat
gctttggatctgggacttcacttctgtaagcaaatgtgcacgaaaacaaaatggaagaag
cagtcgctgaaagtgctcgcttttgtacaacgtctcggagaggttttccagcaattgatg
cgtgctgaaattgaatgtgattgtctggaaacagcgaaagcattggtttatgaaatatct
attaatgacgaagcactaatcggaattatcgatggcgatcaagttctccgtcaactgaag
ctcgcggaagactcgaaaactgtcaaatcgaatgctcgacgacagtttatcaataaagga
tcaacgtttggcgctcctcgtcaactctattccactcttcaaccggtctaa

DBGET integrated database retrieval system