KEGG   Caenorhabditis elegans (nematode): CELE_K12D12.2Help
Entry
CELE_K12D12.2     CDS       T00019                                 

Gene name
npp-3
Definition
Protein NPP-3
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_K12D12.2 (npp-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(11865688..11865851,11865907..11866124,11866532..11866671,11866730..11867119,11867183..11867245,11868142..11868231,11869701..11869842,11869904..11870649,11870696..11871000,11871064..11871411,11871847..11871952,11872005..11873599,11873754..11873958,11874008..11874099,11874160..11874511,11874559..11874693))
Genome map
AA seq 1696 aa AA seqDB search
MWIEIRKFYELIVSFTAFDDDRKINELFNEIEKYRWRLSNILLNPRRTGKDREKLKPGNV
EMAGVEVALDEEICSEALILSDIFQLNELEAVDLILAGEAQKIHFEGLNRGLIAVVCYYD
AHRLLIATMRQMLKWDREDIPQRISKFLNSTFINEDVIKNLFQQLINFTVQSEFARLQSP
DVNGLGGSKHQKLVRNAIEEIRSEVIGCISMICEIPGGNAVSISNHLFQIVKAVPPEKLS
CSSLTAWISLVKITSSEVLSQVHDAQQVLTNMIAHIRNETDWSDQAMCGTLQLACAVALK
SIASSPSDHLGIENIKVDVERVIDRSIRNMAFHYLRQAIIKSEHFRYAHQFMIIDELLKQ
LISYFPAKLMETERNSTDELNFLDDQKKEQSTTQKPDPKSQTVHITDKVTAQLSSTDPSN
NYDSALSQYENFLRCFVDLYEMQVTDYAHQKNARTARERELQEQIEENSMAFSTERSIEL
CRLLERARLPNHHVVHSVAYLEMCAAVCKNENTAALLYDIFSKEHCGPDSYGWESLASAL
KGYDRLYREQKYASNSRHNQSQTMSMSTSFHQQQSLNLTLRPGDKITIPAQELSGLVAWI
HMATKVAQLNERAAMRFSDDPSWTLCSVVASLSTSPVPLSMKASMLDLLTAVARLKGSAP
RIWQAIHLNQLCYSSDGGTLMGIQQELEERECVAKQYDVSLAFVKLMTTLLMHRSLPEYA
TPFIQFVTRSILAHFSTRSYNSVVQMWELAEWSLRATNALLEHGIVEPRAVASNEVHIAI
LTQCLNDTPMYRAITRVIMEDCQAHNDPYVTRQSPSSDAALIALRILSRAIILHPALRAC
ARVSSSDIMIASIPSLVFSPIISASACTPLDLVFHYLHMTDDYPVHSLYAARILRDVMAT
RGAAEVKMLELLRSRNSAASHVRAVRAAICATSIQYTIDDSLAKEEDTDNPHFARGETAR
ILIETLSDAIDCQVTRTGNRLTDTNNICYYLLAFRPSKAHTKELYQADDVLTGLHYVLYI
IEQFVMSKKPFDLPFSALLEPAFRLMQRLVSITCPFSKPVLCFMRSSNIIEKLTTSPFIC
SALTLESARDNTYAQGVFAVRRMIVGYILHFAAVEISAMLTTGHFSRPEKLYRALLESSS
LVAEYTQMEEDDDDEDMAPVASGSNDKANLLFSLIRRATVPRKNELLYPNLVHFDVAKLH
ELFDACLTVNIYGVAQYDVLYLNRLLRREIETVYTESGEMKYVQKEMEGVLEYCAEINAS
LLSESASERIVSGCTALLNVFSVFAPVNFFSNKMQIVIFRDACYVLIEMASGVGGSSLVT
ACQTFHRLVLTLTKLAQVEYPRLLDLREFFAPLFKSMIDLFLQPGEKCVDAKVQLYKTMR
FILRTLFEKNSIDTVNEAEEWLLDGLIAPLETPSSDEIVNIVDKMADEIARHLEGSIADL
PKHRKAAGIMLANDLIHEDLKGNKKICNHFSKSGVPRILCEELLHIDFDWNIVTAARKEG
GGGVAGVNQAEHISNYNLFISILTFLTRYGTSESGWHVLAELAVSEILAEMPPFIEPPKE
LFLKPETVKVKGTSAHAYANALDLGLHFCKQMCTKTKWKKQSLKVLAFVQRLGEVFQQLM
RAEIECDCLETAKALVYEISINDEALIGIIDGDQVLRQLKLAEDSKTVKSNARRQFINKG
STFGAPRQLYSTLQPV
NT seq 5091 nt NT seq  +upstreamnt  +downstreamnt
atgtggattgagattcgtaaattttacgaactcatcgtctccttcacagctttcgatgac
gaccgaaaaataaacgagctgttcaacgaaatcgagaaatacagatggcgattgagcaat
attcttttgaatccgagacgaacgggtaaagatcgggaaaagctgaagccaggaaatgtg
gaaatggcaggagtggaagttgcgctagacgaggaaatctgttcggaagcactcattttg
tcggatatctttcaattaaatgagctggaagctgtggatttgattttggccggagaagct
caaaaaatacatttcgaaggcctcaacagaggattaatcgctgtcgtttgctactatgat
gcgcacaggctcctaatcgcaacaatgcgccaaatgctaaaatgggaccgagaggatatt
cctcaacgtatcagcaagttcctcaatagcacattcatcaacgaggacgtgatcaaaaac
ctttttcaacaactaatcaatttcaccgttcaatcagaatttgcacgacttcaatctcca
gatgtcaacggtttaggaggctctaaacatcagaaattggtcagaaatgccattgaggag
attcgaagtgaagtaattggttgcatttcgatgatctgtgagattccgggaggaaacgca
gtttcgatttcaaatcatttattccaaattgtaaaggcagttccaccggagaagctcagt
tgtagtagcttgacagcctggatttctctcgttaaaatcacatcgagtgaagtgttgtct
caagttcacgatgctcaacaagtgctcacaaacatgatcgcccacattcggaatgaaaca
gactggtcggatcaagcaatgtgcggaactctacagctagcatgcgctgttgctctgaaa
tcgattgcctcatcgccatcagatcatctagggatcgagaatatcaaggtggacgtggaa
agagtcatcgatcgatctatccggaatatggcttttcattacttgcgacaagcgatcatc
aagtcggaacacttccgttatgcccatcagtttatgattattgatgagcttctgaaacag
ctgatttcatatttccccgcgaagcttatggagactgaaagaaattctacagacgagctg
aacttcctggatgatcagaaaaaggaacaatcaacgactcaaaaaccggatccgaaaagc
caaacagtccacataacggacaaagttacagctcaactgagctctacagatccatcgaac
aactatgattcggctctatcacaatatgagaacttccttcgatgctttgtggatttatac
gagatgcaagtgaccgactatgcacatcagaagaatgcgagaacagcacgcgaacgagag
cttcaggagcaaatcgaagagaacagcatggcttttagtacggagagatcgattgagctc
tgccggctcctggaacgtgctcgtcttccaaaccatcatgttgttcattcagttgcttat
ctggaaatgtgcgctgctgtatgcaaaaatgagaacacagctgctctactttatgacatc
ttctccaaagaacattgtggaccagattcatatggatgggaatctctggcttcagcactc
aaaggctacgatcgtttgtaccgggagcagaagtatgcgtcgaattctcgtcacaatcaa
agtcagacaatgagtatgagcaccagcttccaccaacaacaaagcctcaatctcacactt
cgtccaggcgacaaaatcaccatcccagctcaagagctcagcggactagtagcctggatc
catatggctacaaaagttgctcaattgaatgaacgagccgctatgcgattctcggatgat
ccttcatggacgttgtgttctgttgtcgcatcgctctccacttctccagtaccgctatct
atgaaagcatcgatgcttgatttgctgacggcagtggcacggctcaaaggatccgcaccg
agaatttggcaagcaattcatctgaatcaattgtgctattcttcggatggtggaacacta
atgggaatccagcaggagctcgaggaacgagaatgtgtcgcgaagcaatatgatgtgtcg
ttagcttttgtgaaattgatgacgacccttctgatgcacagatctctaccggaatacgct
acaccattcatccaattcgtcaccagaagtattttggcacatttctccacacgcagctat
aatagcgttgttcaaatgtgggagctcgccgagtggtcgctccgagccaccaacgcactt
ctcgagcacggaatcgtcgagccgagagccgtggcatcgaacgaagttcatattgccatt
ttgacgcagtgcctcaatgatacgccgatgtacagagctatcacgcgggttattatggag
gattgtcaagctcacaatgatccgtacgtcacacggcagtctccatcatccgatgcagct
ttgattgcactgcgaattttatcacgagcaataattctgcatccggctcttcgtgcgtgt
gcccgtgtctcatccagtgatattatgatcgcttccattccatccctcgtcttctcacca
atcatctcagcctccgcttgcacacctcttgatctcgtcttccattaccttcatatgact
gatgactacccggtacactctctctacgctgccagaattcttcgagacgtgatggctaca
cgtggagctgccgaggtgaagatgctcgagttgttaagatccagaaactcggctgcatct
catgttcgggcggttcgagcggcgatctgcgctacgtcgattcagtatacgattgatgat
tcattggcgaaagaagaagacacagataatccacatttcgcgagaggagaaaccgctcga
attctcatcgaaactctttcggacgccatcgattgccaagtaacaagaaccggaaatcgt
ctgactgataccaacaatatttgctactaccttctcgcattccgaccatcaaaagcccat
accaaggagctgtatcaagcggacgacgtgctcaccggtcttcactatgttctgtatatt
atcgagcaatttgtgatgtcgaagaaaccattcgatttacctttctcagcgctactagag
cctgcattccggctgatgcaaagacttgtctcgatcacgtgcccattctctaaaccagtg
ctctgcttcatgcgatcttcaaatattatcgagaaattgacaacatctccattcatctgt
tcggctctcactctggaaagtgcccgcgacaatacatatgctcaaggtgtattcgctgtt
cgtcgtatgattgttggttacattcttcacttcgccgccgtcgaaatttcggcaatgctc
actactggccacttttctcgacctgagaagctttatcgtgcactcttggaatcatcatct
cttgttgctgaatatactcaaatggaagaagacgacgatgatgaagatatggctccagta
gcttccggaagcaatgacaaggcgaatttgctattctcgttgatccgacgagccacagtg
ccacgaaagaacgagttactttacccgaatctcgtgcatttcgatgtggcaaaacttcac
gaactctttgacgcatgccttacagtgaacatctacggcgttgcacaatatgacgttctc
tacttgaaccgactattacgacgagagattgagacagtctatacggaatcaggcgagatg
aaatatgtacaaaaagagatggaaggagtccttgaatattgtgctgaaattaacgcaagt
ctcttatcggaaagcgccagtgagcgaattgtgtctggatgtactgcgctactcaacgtc
ttctccgttttcgcccccgtcaactttttctccaacaaaatgcaaattgtcatattccgc
gatgcctgctatgtgcttatcgaaatggcatcaggagttggaggaagctccttggtgaca
gcctgtcagacgttccaccgactcgtactgacactcaccaagttggctcaagttgaatat
cctcgacttctcgatcttcgcgaattctttgcaccactgttcaaaagtatgatcgacctg
tttctacagcctggagagaagtgtgttgatgcaaaagttcaactctacaaaacgatgcgc
ttcatcctacgaacattgtttgagaagaatagcattgacacagtaaatgaagctgaagaa
tggcttctcgacggactcatcgcaccactggagaccccatcatcggatgaaattgtcaat
attgtggataagatggccgacgagatagcacgacatctggagggaagtattgccgatcta
ccgaagcataggaaggccgctgggataatgctggccaacgatttgattcatgaggatttg
aagggcaacaagaagatttgcaatcacttttcgaagagtggagtgccgcggattttgtgc
gaggagctgttgcacatcgatttcgactggaatattgtgacagctgcaaggaaggaaggt
ggtggaggtgttgctggggttaatcaagcggagcacatttctaattacaacttgttcatc
tcgattttaacattcctgacgcgctacggaacttcagaatctggatggcacgttcttgcc
gagcttgctgtttcggagatccttgccgagatgcctccgttcattgaaccaccgaaagag
ctctttttgaaacccgaaactgttaaagtaaagggaacctctgcccacgcttatgcaaat
gctttggatctgggacttcacttctgtaagcaaatgtgcacgaaaacaaaatggaagaag
cagtcgctgaaagtgctcgcttttgtacaacgtctcggagaggttttccagcaattgatg
cgtgctgaaattgaatgtgattgtctggaaacagcgaaagcattggtttatgaaatatct
attaatgacgaagcactaatcggaattatcgatggcgatcaagttctccgtcaactgaag
ctcgcggaagactcgaaaactgtcaaatcgaatgctcgacgacagtttatcaataaagga
tcaacgtttggcgctcctcgtcaactctattccactcttcaaccggtctaa

DBGET integrated database retrieval system