KEGG   Caenorhabditis elegans (nematode): CELE_K12G11.4Help
Entry
CELE_K12G11.4     CDS       T00019                                 

Gene name
sodh-2
Definition
Protein SODH-2
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CELE_K12G11.4 (sodh-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_K12G11.4 (sodh-2)
  Lipid metabolism
   00071 Fatty acid degradation
    CELE_K12G11.4 (sodh-2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CELE_K12G11.4 (sodh-2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_K12G11.4 (sodh-2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_K12G11.4 (sodh-2)
   00982 Drug metabolism - cytochrome P450
    CELE_K12G11.4 (sodh-2)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CELE_K12G11.4 (sodh-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(11889719..11889940,11890244..11890792,11890902..11891186))
Genome map
AA seq 351 aa AA seqDB search
MSSANIPATQSALIFEKYGGPLEVRQVSVPQPQENELLVKIEYSGICHSDLHTWEGDFEY
ASICPLIGGHEGAGTVVTIGSKVKGWNIGDRAGIKLINANCLNCEYCKTGHEPLCDHIQN
YGIDRHGTFQEYLTIRDIDAIKVSNDTNLAAAAPVLCGGVTAYKSLKATNVKPGQIVVLT
GAGGGLGSFGIQYAKAMGMRVVAVDHISKEDHCRNLGAEWFVDAFDTPDIVAHIRKLTNG
GAHGVVSFAAAKKPMEYALEYVRKRGTVVFVGLPKDGTIPLDTLSLICNEITVKGSIVGS
RMDVDEAIDFITRGIVHVPIELVKLEDVPSVYQRMKDGKVTSRVVVDFSMR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagctaatattcctgccacgcaaagtgctttaatatttgaaaaatatggagga
cctctcgaagttcgacaagtttcagttccacaaccgcaagaaaatgaacttttagtgaaa
atcgaatattctggaatttgccattctgatcttcatacgtgggaaggtgattttgaatat
gcttccatttgtcctttaattggagggcatgaaggtgctggaactgttgtgactattggc
tcaaaagttaaaggatggaacattggtgatcgagcaggaatcaagcttatcaacgcaaat
tgcctaaattgtgaatactgtaaaacaggacacgaaccgctttgtgatcatatccaaaac
tacggaatagaccgccatggaacctttcaagaatatctaactattcgggatattgatgcc
attaaagtttcgaatgacacaaatctcgcagcagctgctccagtattatgtggtggagta
actgcatataaatccctgaaagcaacaaatgtgaaaccaggccaaatagttgtactaacg
ggtgctggaggaggattaggatcttttggaattcaatacgcaaaagcaatgggaatgaga
gttgttgctgttgatcatattagcaaagaagatcactgcagaaatcttggagctgaatgg
ttcgtcgatgcttttgataccccagacattgtggctcatattcgaaaattaacgaatgga
ggagcacatggtgttgttagttttgcagcagccaaaaagccaatggaatatgctttggaa
tatgtcagaaaaagagggaccgtggtgtttgttggtcttccaaaagatggaacgattccc
cttgatacactttcactaatttgcaatgaaataactgtgaagggatcaattgttggatca
cgcatggatgttgatgaagcaatcgattttattactcgtggaattgtgcatgttccaata
gaacttgtaaaactcgaagatgttccaagtgtctatcaacgaatgaaagacgggaaggtc
acttctcgtgttgttgtcgatttttcaatgcgatga

DBGET integrated database retrieval system