KEGG   Caenorhabditis elegans (nematode): CELE_M02D8.4Help
Entry
CELE_M02D8.4      CDS       T00019                                 

Gene name
asns-2
Definition
Protein ASNS-2, isoform B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_M02D8.4 (asns-2)
Enzymes [BR:cel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CELE_M02D8.4 (asns-2)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C44
   CELE_M02D8.4 (asns-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(8748959..8749468,8749523..8749928,8749977..8750146,8750195..8750284,8750594..8750732,8750780..8750862))
Genome map
AA seq 465 aa AA seqDB search
MCGVFSICQQTCKNKPKYDLDEARKLSRRQHHRGPDFSGCYQDTKTGDILVHERLAIMDL
GVVQPLQGTAPNRQVIHNGEIYNHQELRDTELKKYNLKTHCDSEVIIFLYEKYRDGHICN
LLDGVFAFVLCCDGDFLAARDPLGVKQMYYGIDDDGRYFFSNEMKCLEDSCGDNKIESFP
PGHYYTPKTGFVRYFNPEWFDFRKAIHPLDLKLLQKTMIASVHKRLMSDAPIGVLLSGGL
DSSLVSSIASREMKRRGMAVHSFSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIEVSRT
CVSLFGILSLMMSHPFVLLLQCTSSPKKSGNWESKLFFLEKELMKSSVDISTSTMPHPMR
TFKRKPSIVFFISTHLIVFVLTSLRWLTQSKFVFHSWIKHLLRLQSVWTLHLSAHKNLKM
GETARSLFSDQLSTRTNTHICLMRFCGDKKNSSPTELDTAGLTLS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgtattctcaatttgccaacaaacatgcaaaaacaagccaaagtacgaccta
gatgaggctcgcaagttgtccagaagacaacaccatcgtggaccggacttcagtggatgc
taccaagacacgaagactggagatatactagtccacgagcgtctagccattatggatcta
ggtgttgttcaaccacttcaaggaacagccccaaaccgtcaggttatacacaacggtgaa
atctacaaccatcaagaactccgtgacaccgagctgaagaaatacaatttgaaaacccat
tgcgattcagaggttattattttcttgtacgagaaataccgtgacggacacatctgcaac
cttcttgatggagtttttgcatttgttctttgttgcgatggagatttccttgctgctcgt
gacccacttggcgtaaaacaaatgtactacggaattgatgacgatggaagatacttcttc
agtaacgagatgaagtgcttggaagatagttgcggagataacaaaatagaatcgttccca
cccgggcactactacactcctaaaacgggattcgttcgctatttcaacccagaatggttc
gacttcagaaaagcgatccatccattggacctcaaacttctccaaaaaaccatgatagct
tcagtccacaagagattaatgtccgatgcaccaattggagttttgctctcgggaggactt
gattccagtctggtctcttcaattgcttcaagagaaatgaaaaggagaggaatggccgtt
cactcgttctccattggtgtcgatcacaactccccagatgttgtggctgctagaaaagtt
gcaaagtttattggaactactcatcatgagttctatttcagcattgaggtatcaagaacc
tgcgtaagcttatttggcatcttgagtcttatgatgtcacatccattcgtgcttctactc
caatgtacttcctctccgaagaaatcaggaaattgggaatcaaagttgttctttctggag
aaggagctgatgaaatcttcggtggatatctctacttccacaatgccccatccgatgagg
actttcaaaaggaaaccatcgatcgtgttcttcatctctacacatctgattgtcttcgtg
ctgacaagtcttcgatggctcactcagtcgaagttcgtgttccattcctggataaagcat
ttgttgaggctgcagtcagtttggaccctgcatttaagcgcccacaaaaacttgaagatg
ggagaaactgcgagaagtttgttctccgatcagctttcaacacggaccaatacccatatc
tgcctgatgagattttgtggagacaaaaagaacagttctccgacggagttggatacagct
ggattgacactctcatga

DBGET integrated database retrieval system