KEGG   Caenorhabditis elegans (nematode): CELE_M04F3.1Help
Entry
CELE_M04F3.1      CDS       T00019                                 

Gene name
rpa-2
Definition
Protein RPA-2
Orthology
K10739  
replication factor A2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CELE_M04F3.1 (rpa-2)
   03420 Nucleotide excision repair
    CELE_M04F3.1 (rpa-2)
   03430 Mismatch repair
    CELE_M04F3.1 (rpa-2)
   03440 Homologous recombination
    CELE_M04F3.1 (rpa-2)
   03460 Fanconi anemia pathway
    CELE_M04F3.1 (rpa-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(4770304..4770387,4770435..4770756,4770806..4771266)
Genome map
AA seq 288 aa AA seqDB search
MWNETVEHENAGNGWAAGESSFMTDRKPDSKATTLGERLPVPVTISNLIEHFSAQDDKYV
VGTFRFATVLTVGIVKDISQDGTTYTYDLCDPNNTEMEYRTLKYDNEGSTFDHSSIVEGT
RVRAIGKLKGFDGNNTIMLFNITPVEDDKDFTIFELEAEAARLFFQKNVSEKLKSVDSDG
FQGMLAPPKSRMSQTSHQSSQGSDTKERLYAQPQKVMTGANQGDVLRERITAVLMAVPEG
SRDEGRHVSWIAEQIQETNISIVRKCVGEMVENGLVYTTVDEETVSAI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgagactgtcgagcacgagaacgcaggaaacggatgggccgctggagagtcg
tcgtttatgaccgacagaaagcctgactcgaaggctacaactctcggcgagaggctccca
gtgccggtcacgatttccaatctgatcgagcacttttctgcgcaggatgacaagtatgtc
gtcgggactttccgattcgcaacggtgttgaccgtcggtattgtgaaggatatcagtcag
gatgggacaacgtacacgtacgacctctgtgatccaaacaacacggagatggaatatcgt
acgctcaagtatgacaatgagggttcgacattcgatcattcttcaattgtcgagggaact
cgtgttcgagccatcggaaagctcaagggattcgatggaaacaataccattatgctgttc
aacatcactccagttgaagacgacaaggatttcacgatcttcgagctcgaggcagaagct
gcacgtctgttcttccaaaagaacgtgagcgagaaactgaagtcggtcgactcggatggc
ttccaaggaatgctggcaccaccgaagagcagaatgtcacaaacatcgcatcaaagctcg
caaggatcggacaccaaggagagattgtatgctcaaccgcaaaaagtgatgacgggagcg
aaccaaggagatgtgctcagagagcgcattaccgccgtcttgatggctgtgccagagggt
tctcgtgacgaaggtcgacatgtttcgtggatagctgagcaaattcaagaaacgaacatt
tctattgttcgtaagtgcgtcggtgagatggtcgagaacggattggtctacaccactgtc
gacgaggaaactgtttccgctatttaa

DBGET integrated database retrieval system