KEGG   Caenorhabditis elegans (nematode): CELE_M05B5.4Help
Entry
CELE_M05B5.4      CDS       T00019                                 

Gene name
M05B5.4
Definition
Protein M05B5.4
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_M05B5.4 (M05B5.4)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CELE_M05B5.4 (M05B5.4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CELE_M05B5.4 (M05B5.4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(7188539..7188653,7188942..7189101,7189153..7189370,7189580..7189722,7189771..7189919,7190022..7190490)
Genome map
AA seq 417 aa AA seqDB search
MRDILVSLCIFLVLIGKSDTKWFGKFGRSQAKGLPVILVPGDGGSQLESNLTGKPSVVHY
VCSKQTADYFDLWLNLQLFTPLVIDCWADNMQLVFNTTTGLSENMPGVDIRVAGFGATES
VEWLDKSKASQGRYFFDIVDSMVSWGYRRGKNVIGAPFDWRKSPNELNDYLIQLKSLIET
TYRWNDNQKIVLVGHSMGNPLSLYFLNNYVDQAWKDKYISSFVSLAAPWAGSMQIVRLFA
SGYNMNYYRVILPPSSLRAMQRSFSSSAFLFPSPVAWKPHEILATTADKNYTVGNIKEFF
QDINYMVGWEQYKQAARLNGNLSSPGVPVHCIYGTGVPTPEKFSWAPGYFPDYPPTEFMG
DGDGTVNKKSATVCTNWIGNNNGYKVTVHEVFQADHMAILKHPNAIELVRKAIFQLI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgggatatcctggtttctttgtgtattttcttggttttaattggaaaaagtgacacg
aaatggtttggaaagtttggcagatcacaagcgaaaggacttccggtgattctcgtgcct
ggtgatggaggcagccagctggaatcaaatctaacgggtaaaccatcagttgtgcattat
gtttgctccaagcagacagccgattattttgatctttggcttaatctacaacttttcaca
cctttggttattgattgttgggctgataacatgcaattagtgttcaacacaaccacagga
ttgtctgaaaacatgccaggagttgacattagagttgctggatttggagcaactgaaagt
gttgaatggttggataagagtaaagcatcacagggaagatacttctttgatatcgttgat
tcgatggtttcatggggttatcgaagaggaaaaaatgtcattggagcaccttttgattgg
agaaaatccccaaatgaattaaacgattatctcattcaactgaagtccttaattgaaacc
acatatcgctggaatgacaatcaaaagatcgtactcgtcggtcacagtatgggtaatccc
ctttctttgtatttcttgaataattatgtggatcaggcttggaaagacaaatacatatcg
agttttgttagtttggcggctccatgggctggatcaatgcaaattgttcgattatttgca
tctggatataatatgaattattatagagttattctaccaccgagtagcttgagagcaatg
caaagatcattctcctcttcggcctttctgtttccaagtccagttgcatggaaaccacat
gaaatattagcgacaactgctgacaaaaactacactgttggaaatattaaagaattcttt
caagacattaattacatggttggatgggaacaatacaaacaggccgcccgtctgaatgga
aatttaagttctccaggagttccagttcattgtatttatggaacaggagtccccacaccg
gaaaagttttcatgggctcccggatactttccagattatccaccaactgaattcatgggt
gatggagacgggacagtgaacaaaaaatcagctacagtgtgcactaattggattggaaat
aataatggttataaggttactgtacacgaagtatttcaagctgatcacatggcaattctt
aaacatccaaatgcaattgaacttgtccgaaaagccattttccagttaatttga

DBGET integrated database retrieval system