KEGG   Caenorhabditis elegans (nematode): CELE_M05B5.4Help
Entry
CELE_M05B5.4      CDS       T00019                                 

Gene name
M05B5.4
Definition
Protein M05B5.4
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cel00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cel04142]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(7188537..7188651,7188940..7189099,7189151..7189368,7189578..7189720,7189769..7189917,7190020..7190488)
Genome map
AA seq 417 aa AA seqDB search
MRDILVSLCIFLVLIGKSDTKWFGKFGRSQAKGLPVILVPGDGGSQLESNLTGKPSVVHY
VCSKQTADYFDLWLNLQLFTPLVIDCWADNMQLVFNTTTGLSENMPGVDIRVAGFGATES
VEWLDKSKASQGRYFFDIVDSMVSWGYRRGKNVIGAPFDWRKSPNELNDYLIQLKSLIET
TYRWNDNQKIVLVGHSMGNPLSLYFLNNYVDQAWKDKYISSFVSLAAPWAGSMQIVRLFA
SGYNMNYYRVILPPSSLRAMQRSFSSSAFLFPSPVAWKPHEILATTADKNYTVGNIKEFF
QDINYMVGWEQYKQAARLNGNLSSPGVPVHCIYGTGVPTPEKFSWAPGYFPDYPPTEFMG
DGDGTVNKKSATVCTNWIGNNNGYKVTVHEVFQADHMAILKHPNAIELVRKAIFQLI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgggatatcctggtttctttgtgtattttcttggttttaattggaaaaagtgacacg
aaatggtttggaaagtttggcagatcacaagcgaaaggacttccggtgattctcgtgcct
ggtgatggaggcagccagctggaatcaaatctaacgggtaaaccatcagttgtgcattat
gtttgctccaagcagacagccgattattttgatctttggcttaatctacaacttttcaca
cctttggttattgattgttgggctgataacatgcaattagtgttcaacacaaccacagga
ttgtctgaaaacatgccaggagttgacattagagttgctggatttggagcaactgaaagt
gttgaatggttggataagagtaaagcatcacagggaagatacttctttgatatcgttgat
tcgatggtttcatggggttatcgaagaggaaaaaatgtcattggagcaccttttgattgg
agaaaatccccaaatgaattaaacgattatctcattcaactgaagtccttaattgaaacc
acatatcgctggaatgacaatcaaaagatcgtactcgtcggtcacagtatgggtaatccc
ctttctttgtatttcttgaataattatgtggatcaggcttggaaagacaaatacatatcg
agttttgttagtttggcggctccatgggctggatcaatgcaaattgttcgattatttgca
tctggatataatatgaattattatagagttattctaccaccgagtagcttgagagcaatg
caaagatcattctcctcttcggcctttctgtttccaagtccagttgcatggaaaccacat
gaaatattagcgacaactgctgacaaaaactacactgttggaaatattaaagaattcttt
caagacattaattacatggttggatgggaacaatacaaacaggccgcccgtctgaatgga
aatttaagttctccaggagttccagttcattgtatttatggaacaggagtccccacaccg
gaaaagttttcatgggctcccggatactttccagattatccaccaactgaattcatgggt
gatggagacgggacagtgaacaaaaaatcagctacagtgtgcactaattggattggaaat
aataatggttataaggttactgtacacgaagtatttcaagctgatcacatggcaattctt
aaacatccaaatgcaattgaacttgtccgaaaagccattttccagttaatttga

DBGET integrated database retrieval system