KEGG   Caenorhabditis elegans (nematode): CELE_R03G5.2Help
Entry
CELE_R03G5.2      CDS       T00019                                 

Gene name
sek-1
Definition
Protein SEK-1
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_R03G5.2 (sek-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CELE_R03G5.2 (sek-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CELE_R03G5.2 (sek-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(7816804..7816816,7816876..7816966,7817074..7817206,7818326..7818709,7818861..7819111,7819174..7819285,7820037..7820063)
Genome map
AA seq 336 aa AA seqDB search
MERKGRERKLPGMKIVMPTPVETPTMNLEDRCLIKLTNESEEIEIAATDLVVLEELGKGG
YGIVEKMQHRQSGIIMAVKRIKSSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREG
DVWICMEVMDTSLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPS
NILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGETKSAYDVRADVWSLG
ITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERP
KYPELLAMPFMEQARNEKQFSMARFINEILDTVWRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaaaaggacgtgagcgcaagctgccgggcatgaagatcgtgatgccaacaccg
gtcgagacgcccacaatgaatctggaagacagatgtcttatcaaattgacaaacgagtcc
gaagagattgagattgccgccaccgacctcgtcgtactcgaagaacttggaaaaggtgga
tatgggattgtggagaaaatgcagcacaggcagagcgggataattatggcggtaaaacga
atcaaatcatcaatcaacgatcaatctcaaaagcagatgctcaacgagctagacgcgtgc
aggagaagtgattgctgtccgcaaatggtacggttctatggagcaatgtttcgcgaaggt
gatgtctggatttgcatggaagtgatggacacgtcgctggacaaattttaccggcacgca
tacaaaattggcaaacacattccagagccgtttattgggaaaatggctctgtcggtcatt
gaaggactcaactttatgaaagagcaactgaatttgattcatcgagacgtgaaaccgtcg
aacattctgttaaatcgacatggacaagtcaagatttgcgattttggaatttcaggtcac
ttgacaaacagcatggccaagactgtacaagccggatgcaaaccttacatgccaccagag
agaattgatggagagactaagtcagcctatgatgtgagagctgatgtatggagtttgggt
ataacaataattgaaatcgccgttggcacccatccctacgcaaattggaaaaccccattt
gaacaattgaaacaggttgtgaaagagccgccaccaaaattgccgatggaaagtggtttt
agtgttgattgtcagtactttgtcaagagatgtcttgaaaaggattacaatgaacgtccc
aaatatccggaattattggcgatgccgtttatggagcaggcaagaaatgagaagcaattt
agtatggctcggtttatcaatgagattctcgacactgtttggcgacgatga

DBGET integrated database retrieval system