KEGG   Caenorhabditis elegans (nematode): CELE_R03G5.2Help
Entry
CELE_R03G5.2      CDS       T00019                                 

Gene name
sek-1
Definition
Protein SEK-1
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cel04010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(7816753..7816765,7816825..7816915,7817023..7817155,7818275..7818658,7818810..7819060,7819123..7819234,7819986..7820012)
Genome map
AA seq 336 aa AA seqDB search
MERKGRERKLPGMKIVMPTPVETPTMNLEDRCLIKLTNESEEIEIAATDLVVLEELGKGG
YGIVEKMQHRQSGIIMAVKRIKSSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREG
DVWICMEVMDTSLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPS
NILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGETKSAYDVRADVWSLG
ITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERP
KYPELLAMPFMEQARNEKQFSMARFINEILDTVWRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaaaaggacgtgagcgcaagctgccgggcatgaagatcgtgatgccaacaccg
gtcgagacgcccacaatgaatctggaagacagatgtcttatcaaattgacaaacgagtcc
gaagagattgagattgccgccaccgacctcgtcgtactcgaagaacttggaaaaggtgga
tatgggattgtggagaaaatgcagcacaggcagagcgggataattatggcggtaaaacga
atcaaatcatcaatcaacgatcaatctcaaaagcagatgctcaacgagctagacgcgtgc
aggagaagtgattgctgtccgcaaatggtacggttctatggagcaatgtttcgcgaaggt
gatgtctggatttgcatggaagtgatggacacgtcgctggacaaattttaccggcacgca
tacaaaattggcaaacacattccagagccgtttattgggaaaatggctctgtcggtcatt
gaaggactcaactttatgaaagagcaactgaatttgattcatcgagacgtgaaaccgtcg
aacattctgttaaatcgacatggacaagtcaagatttgcgattttggaatttcaggtcac
ttgacaaacagcatggccaagactgtacaagccggatgcaaaccttacatgccaccagag
agaattgatggagagactaagtcagcctatgatgtgagagctgatgtatggagtttgggt
ataacaataattgaaatcgccgttggcacccatccctacgcaaattggaaaaccccattt
gaacaattgaaacaggttgtgaaagagccgccaccaaaattgccgatggaaagtggtttt
agtgttgattgtcagtactttgtcaagagatgtcttgaaaaggattacaatgaacgtccc
aaatatccggaattattggcgatgccgtttatggagcaggcaagaaatgagaagcaattt
agtatggctcggtttatcaatgagattctcgacactgtttggcgacgatga

DBGET integrated database retrieval system