KEGG   Caenorhabditis elegans (nematode): CELE_R03G5.5Help
Entry
CELE_R03G5.5      CDS       T00019                                 

Gene name
gpx-7
Definition
Protein GPX-7, isoform B
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CELE_R03G5.5 (gpx-7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CELE_R03G5.5 (gpx-7)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CELE_R03G5.5 (gpx-7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(7799408..7799570,7799626..7799780))
Genome map
AA seq 105 aa AA seqDB search
MYVQKLVNDDNAFHFFISLLNQRLKIDMSTGTIYDFSVRDNSGDLVSLDKYSGLVVIIVN
VASYCGLTNSNYKELKSLNDKYHLRGLRVAAFPCNQFGFQACGLN
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttcaaaaattggtaaacgatgataacgcatttcatttctttatttcattgctg
aaccagagattgaaaattgatatgtcgacggggacaatttatgatttcagtgtaagagac
aatagtggagatttggtttctttagacaaatacagcggacttgttgtcatcatagtgaat
gttgcatcatactgcggactgacaaattccaactacaaagaactgaagtctctgaacgac
aaatatcatttgcgtggactacgcgttgctgcttttccatgcaaccaatttggatttcag
gcttgtggtttgaattaa

DBGET integrated database retrieval system