KEGG   Caenorhabditis elegans (nematode): CELE_R05G6.8Help
Entry
CELE_R05G6.8      CDS       T00019                                 

Gene name
plc-4
Definition
Protein PLC-4
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CELE_R05G6.8 (plc-4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    CELE_R05G6.8 (plc-4)
   04070 Phosphatidylinositol signaling system
    CELE_R05G6.8 (plc-4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CELE_R05G6.8 (plc-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(join(7509678..7509842,7509892..7510436,7510481..7510844,7511176..7511273,7511324..7511624,7511671..7512057,7512219..7512498,7512546..7512661))
Genome map
AA seq 751 aa AA seqDB search
MAKSVSPEEQAAAQAADEEKTKEELEWAEKGSLLCRIKNQKVKEMALVTIKSKQFLNYYS
SYWFNFVPNALKSVALSELLEVRSGYQTDNLQRASKKYEFQELAPESRCFSVIFSHAKFL
HKSVDFSADSKETRDKWVSVLTHLISVAKHQRVVFNETAWLIDKFQQADTNKNGLLSFDE
VWNLLKRMNLQISERYAKAIFRESEFENSRDNKLNEKEFLNFFERLTDRPDLRFVMTQAS
SDNVETLTVADLQRFLTEEQGFENVDLKKAEQILTTFEQTVQDKQKEKLMGLMGMRRLMQ
SRWGNVFKPGHESIFQDMDQPLTHYFVNSSHNTYLTGLQVKGEATVEGYISALRKGARLL
ELDLFDGEHGEPVITHKRTFIESITLRNSLEAIKRTAFETSPYPVILTLENHVGFVQQAV
MADLFKEILGDSLYIPPKDSHRHPLSSPNKLKRKFLLRGKKIILEEDIEEPDEDDSPTDK
DKHHVHPHPVAPELSALIGLPSVKLSHNIYQDVNKHPFDGSPSLSENKVYTMFEAAVPIF
TYTAERLVKSYPKGLRQDSSNMHPMVSWLCGIQSVAMNFQTAGEELDLNAGLFRINGNCG
YVLKPSCLLDGVDPRSMAKPKLKLGIGLFSAQYLPKSEPGKEIIDPYVSVQIFGIPRDET
KAKTRIIKDNGFNPEWRDNFYFTLSCPELAIIRFCVKDFDSTSSNDFVGEFSIPVMSLRT
GFSQIQLNTGYQHTLDPSASLFVRIAMEEEY
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggccaagagcgtatccccagaggagcaggccgccgcacaagctgctgatgaagagaag
acgaaagaagaattagaatgggctgaaaaaggatcgcttttatgtagaattaaaaatcaa
aaagtgaaggaaatggcgttggtgacaataaaaagtaaacaattcctcaactattactca
agttattggtttaattttgtgccaaatgctttgaaatcagttgcactatcggaattgtta
gaagttcgatcgggttatcaaactgacaatctgcaaagagcatcgaaaaaatacgaattc
caagagttggctccagagtctagatgtttctccgttattttttctcatgccaagttcttg
cacaaatcagtagatttcagtgctgattccaaagaaactagagacaaatgggtttccgta
ctgacacatctcatatcagttgccaaacatcaaagagttgtattcaacgaaacagcatgg
ttgattgacaaatttcaacaggcggataccaataaaaacggacttcttagttttgacgaa
gtttggaatcttcttaaacgaatgaatcttcaaataagtgaacgatatgcaaaagcgata
ttcagagaatcagagtttgagaactcgcgagataataaattgaacgagaaagaatttctt
aacttttttgaaagattgactgatcgaccggatcttcgatttgtgatgactcaagcaagt
tctgataacgtggaaacgctgactgttgctgatttgcaaagatttttaactgaagaacaa
ggattcgaaaatgttgatttgaaaaaagccgaacaaattctgactacatttgaacaaact
gttcaagataagcaaaaagaaaaattgatgggattgatgggaatgcgtcgattaatgcag
tcaagatggggaaatgtattcaaaccaggacatgaaagtatcttccaagatatggatcaa
cctctgactcattattttgttaattcatcacataacacatatttgactggcttgcaagtg
aaaggagaagctactgttgaaggttatatttcagctttacgtaaaggagcaaggctttta
gaattagacttgtttgatggcgaacacggagagccagtaatcacacataaaagaaccttt
atcgagtcgattacattgaggaattcgctggaagctattaagagaactgcgtttgaaaca
tcaccatatcctgtcatcctcaccctcgaaaaccacgtcggatttgtacaacaggctgtt
atggcagatttattcaaagaaattcttggagattctttatatattccaccaaaagattca
catcgccatccgttatcatctccgaataagctgaaaagaaaattcctattgcgcggaaag
aaaattattcttgaagaagacattgaagaaccagatgaagatgattcaccaactgataag
gataagcaccatgtacatccacatccagttgcacctgaattatcagctctcattggtttg
ccgtcagtaaaattgagccataatatttatcaagacgtcaacaaacatccatttgatgga
agtccttcgctctcggaaaataaagtatatacaatgtttgaagctgcagttcccatcttc
acttacactgcagaaaggcttgtgaagagttatccaaaaggattacgtcaagattcatca
aatatgcatccaatggtttcttggctttgtggaattcaaagtgttgctatgaacttccaa
accgctggtgaagagcttgatttgaatgcaggattattcagaattaatggaaattgcggt
tacgttctgaaaccaagttgccttctcgatggagtcgatccaagaagtatggccaaacca
aaattgaagcttggtattggacttttctctgctcagtatcttccaaagtcagaacccgga
aaagagatcattgatccatacgtcagtgttcagattttcggaattccacgagatgaaaca
aaagcaaaaacaagaatcatcaaggacaatggattcaacccagaatggagggataatttc
tatttcacactctcgtgcccagagctagcaattattcgattctgtgtaaaagattttgac
tctacatcttcgaacgactttgttggagaattctcaattcctgttatgagtcttcgtaca
ggtttctcgcaaattcaactaaataccggatatcaacatactctggacccatctgcatct
ctttttgtacgaattgcaatggaggaagagtactaa

DBGET integrated database retrieval system