KEGG   Caenorhabditis elegans (nematode): CELE_R05G6.8Help
Entry
CELE_R05G6.8      CDS       T00019                                 

Gene name
plc-4
Definition
Protein PLC-4
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cel00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cel04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cel04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(join(7509667..7509831,7509881..7510425,7510470..7510833,7511165..7511262,7511313..7511613,7511660..7512046,7512208..7512487,7512535..7512650))
Genome map
AA seq 751 aa AA seqDB search
MAKSVSPEEQAAAQAADEEKTKEELEWAEKGSLLCRIKNQKVKEMALVTIKSKQFLNYYS
SYWFNFVPNALKSVALSELLEVRSGYQTDNLQRASKKYEFQELAPESRCFSVIFSHAKFL
HKSVDFSADSKETRDKWVSVLTHLISVAKHQRVVFNETAWLIDKFQQADTNKNGLLSFDE
VWNLLKRMNLQISERYAKAIFRESEFENSRDNKLNEKEFLNFFERLTDRPDLRFVMTQAS
SDNVETLTVADLQRFLTEEQGFENVDLKKAEQILTTFEQTVQDKQKEKLMGLMGMRRLMQ
SRWGNVFKPGHESIFQDMDQPLTHYFVNSSHNTYLTGLQVKGEATVEGYISALRKGARLL
ELDLFDGEHGEPVITHKRTFIESITLRNSLEAIKRTAFETSPYPVILTLENHVGFVQQAV
MADLFKEILGDSLYIPPKDSHRHPLSSPNKLKRKFLLRGKKIILEEDIEEPDEDDSPTDK
DKHHVHPHPVAPELSALIGLPSVKLSHNIYQDVNKHPFDGSPSLSENKVYTMFEAAVPIF
TYTAERLVKSYPKGLRQDSSNMHPMVSWLCGIQSVAMNFQTAGEELDLNAGLFRINGNCG
YVLKPSCLLDGVDPRSMAKPKLKLGIGLFSAQYLPKSEPGKEIIDPYVSVQIFGIPRDET
KAKTRIIKDNGFNPEWRDNFYFTLSCPELAIIRFCVKDFDSTSSNDFVGEFSIPVMSLRT
GFSQIQLNTGYQHTLDPSASLFVRIAMEEEY
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggccaagagcgtatccccagaggagcaggccgccgcacaagctgctgatgaagagaag
acgaaagaagaattagaatgggctgaaaaaggatcgcttttatgtagaattaaaaatcaa
aaagtgaaggaaatggcgttggtgacaataaaaagtaaacaattcctcaactattactca
agttattggtttaattttgtgccaaatgctttgaaatcagttgcactatcggaattgtta
gaagttcgatcgggttatcaaactgacaatctgcaaagagcatcgaaaaaatacgaattc
caagagttggctccagagtctagatgtttctccgttattttttctcatgccaagttcttg
cacaaatcagtagatttcagtgctgattccaaagaaactagagacaaatgggtttccgta
ctgacacatctcatatcagttgccaaacatcaaagagttgtattcaacgaaacagcatgg
ttgattgacaaatttcaacaggcggataccaataaaaacggacttcttagttttgacgaa
gtttggaatcttcttaaacgaatgaatcttcaaataagtgaacgatatgcaaaagcgata
ttcagagaatcagagtttgagaactcgcgagataataaattgaacgagaaagaatttctt
aacttttttgaaagattgactgatcgaccggatcttcgatttgtgatgactcaagcaagt
tctgataacgtggaaacgctgactgttgctgatttgcaaagatttttaactgaagaacaa
ggattcgaaaatgttgatttgaaaaaagccgaacaaattctgactacatttgaacaaact
gttcaagataagcaaaaagaaaaattgatgggattgatgggaatgcgtcgattaatgcag
tcaagatggggaaatgtattcaaaccaggacatgaaagtatcttccaagatatggatcaa
cctctgactcattattttgttaattcatcacataacacatatttgactggcttgcaagtg
aaaggagaagctactgttgaaggttatatttcagctttacgtaaaggagcaaggctttta
gaattagacttgtttgatggcgaacacggagagccagtaatcacacataaaagaaccttt
atcgagtcgattacattgaggaattcgctggaagctattaagagaactgcgtttgaaaca
tcaccatatcctgtcatcctcaccctcgaaaaccacgtcggatttgtacaacaggctgtt
atggcagatttattcaaagaaattcttggagattctttatatattccaccaaaagattca
catcgccatccgttatcatctccgaataagctgaaaagaaaattcctattgcgcggaaag
aaaattattcttgaagaagacattgaagaaccagatgaagatgattcaccaactgataag
gataagcaccatgtacatccacatccagttgcacctgaattatcagctctcattggtttg
ccgtcagtaaaattgagccataatatttatcaagacgtcaacaaacatccatttgatgga
agtccttcgctctcggaaaataaagtatatacaatgtttgaagctgcagttcccatcttc
acttacactgcagaaaggcttgtgaagagttatccaaaaggattacgtcaagattcatca
aatatgcatccaatggtttcttggctttgtggaattcaaagtgttgctatgaacttccaa
accgctggtgaagagcttgatttgaatgcaggattattcagaattaatggaaattgcggt
tacgttctgaaaccaagttgccttctcgatggagtcgatccaagaagtatggccaaacca
aaattgaagcttggtattggacttttctctgctcagtatcttccaaagtcagaacccgga
aaagagatcattgatccatacgtcagtgttcagattttcggaattccacgagatgaaaca
aaagcaaaaacaagaatcatcaaggacaatggattcaacccagaatggagggataatttc
tatttcacactctcgtgcccagagctagcaattattcgattctgtgtaaaagattttgac
tctacatcttcgaacgactttgttggagaattctcaattcctgttatgagtcttcgtaca
ggtttctcgcaaattcaactaaataccggatatcaacatactctggacccatctgcatct
ctttttgtacgaattgcaatggaggaagagtactaa

DBGET integrated database retrieval system