KEGG   Caenorhabditis elegans (nematode): CELE_R05H10.5Help
Entry
CELE_R05H10.5     CDS       T00019                                 

Gene name
R05H10.5
Definition
Protein R05H10.5
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cel00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cel00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(14867599..14867666,14867765..14867851,14868616..14868952)
Genome map
AA seq 163 aa AA seqDB search
MASVHGITVKNAQGEDTPLSNYQGKVLIIVNVASQCGLTNSNYNQFKELLDVYKKDGLEV
LAFPCNQFGGQEPSCEIDIAAFVADKFKFEPTLFQKIDVNGDNTAPLYKFLKQEKGGFLV
DAIKWNFTKFLVGRDGHVIKRFSPTTEPKDMKKDIEAALQAKL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagttcacggaattactgtcaaaaatgctcaaggagaagacactccactctcc
aactaccaaggaaaagttctaatcattgtcaacgtcgcttcacagtgcggactcaccaat
tccaactacaaccagttcaaggagctcctcgatgtgtacaaaaaagacggactcgaagtt
ctcgcattcccgtgcaatcaattcggtggtcaggaaccatcatgcgagatcgatatcgcc
gcgttcgtcgccgacaaattcaaattcgagccaaccctgttccaaaaaatcgacgtaaac
ggagacaacactgctccactgtacaagttcttgaaacaggagaagggcggatttttggtc
gacgcgattaagtggaacttcacgaaattcctcgttggcagagatggtcacgttatcaag
agattctcaccgactactgagccgaaggatatgaagaaggatatcgaggccgcacttcaa
gccaaactttaa

DBGET integrated database retrieval system