KEGG   Caenorhabditis elegans (nematode): CELE_R05H10.5Help
Entry
CELE_R05H10.5     CDS       T00019                                 

Gene name
gpx-2
Definition
(RefSeq) GPX-2, isoform B
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CELE_R05H10.5 (gpx-2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CELE_R05H10.5 (gpx-2)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CELE_R05H10.5 (gpx-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:join(14866766..14866775,14867637..14867742,14867841..14867927,14868692..14869028)
Genome map
AA seq 179 aa AA seqDB search
MLSAARRFISLSTASAMASVHGITVKNAQGEDTPLSNYQGKVLIIVNVASQCGLTNSNYN
QFKELLDVYKKDGLEVLAFPCNQFGGQEPSCEIDIAAFVADKFKFEPTLFQKIDVNGDNT
APLYKFLKQEKGGFLVDAIKWNFTKFLVGRDGHVIKRFSPTTEPKDMKKDIEAALQAKL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcagccgctcgtcgtttcatctcactctcaaccgcatccgcaatggcatcagtt
cacggaattactgtcaaaaatgctcaaggagaagacactccactctccaactaccaagga
aaagttctaatcattgtcaacgtcgcttcacagtgcggactcaccaattccaactacaac
cagttcaaggagctcctcgatgtgtacaaaaaagacggactcgaagttctcgcattcccg
tgcaatcaattcggtggtcaggaaccatcatgcgagatcgatatcgccgcgttcgtcgcc
gacaaattcaaattcgagccaaccctgttccaaaaaatcgacgtaaacggagacaacact
gctccactgtacaagttcttgaaacaggagaagggcggatttttggtcgacgcgattaag
tggaacttcacgaaattcctcgttggcagagatggtcacgttatcaagagattctcaccg
actactgagccgaaggatatgaagaaggatatcgaggccgcacttcaagccaaactttaa

DBGET integrated database retrieval system