KEGG   Caenorhabditis elegans (nematode): CELE_R06A4.8Help
Entry
CELE_R06A4.8      CDS       T00019                                 

Gene name
agl-1
Definition
Protein AGL-1
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CELE_R06A4.8 (agl-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CELE_R06A4.8 (agl-1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CELE_R06A4.8 (agl-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(14350877..14351740,14352113..14352701,14353304..14353730,14353778..14354327,14354373..14354589,14355560..14355912,14355965..14356308,14356380..14356557,14356603..14357402,14357449..14357530))
Genome map
AA seq 1467 aa AA seqDB search
MGEEKEIRIIVLEDGEHLESVIRKIEKGWIVRFKRGSSLLGKKVKVFTSICPGNSLEWSE
GKDHLAVYCQVECKEAGSFRYWFKIEDSEERGSGYFLVMPELKINGKCLPLDGIACQTYL
TKLLGPLSEWKERLEVAHQTGYNMIHLTPIHELGISNSSYSLSDHHSLIKTIQSQDQKFG
FEDVQALVGDLERSWNILTVQDVVWNHAAKNATWLLEHPESAYNCLNSPHLRPAYVIDRV
YHEFGKQIGEGVWEHRGVPPVVDNIHHVNAIEYLLRAEVLPKADLHEFYQVDLKAMVNLF
EVFIKQSSGPTTNPLDGEDVEIEQDLECRRFGNTVDFERSARIFNRHRGDAKSEEERVEK
CVRSFEEALNNKNLEAARESWEVILAGLAAVMGGITYERIADNGPKKGLVSPENPLTTDY
FLHLEADLGWKSEEKFAYDPEKSKFLMAFNGWVMSSDPMKNFALKESQVYLRRELVCWGD
SVKLNYGNKEADSPFLWQYMKEYTQQAARIFHGLRIDNAHGTPIHVAEKLLKTAREVRPD
IYVFAELFTGSEHADNMFVNRLGISSLIREAQSAHDSHEQGRLVYRYGGDCVGAFKQKSA
RLAPKSIAHGLFLDQSHDNPSPIHTRSPFDILPTAAMLTMASCAVGSNRGYDELIRDHIH
VVSEKRPYASWCRPDQVSRSQGIIEGRNLLNKLHTWLAEHGYSQVFVDQMNSDIVGITRH
NPRTHETVVVVSHTSFSKNYIDWPGGLKHIPIGGVLENVIFEMKLKKVQEEWGTEDPDVL
IGLKNYEMEIRENVNLDNGTMFKVHDGYIELTNFPTGSVVGFKIRPSDEATKAFNMIHNS
ITPEQSEFDSALSRLTYQSFPNLLFHCESEDYATIQQGGYDVPNFGKFVYCGLQGLVPVL
EKIRDDNDLGHPLCQNLRDGTWICDYIVGRLAKFEKLGEVSEAIRKFFAPLDHVPYYLRP
CYFELLVSYIYGKIRKEALKRMAPQISSSSALVRHLAISTLSFLGYIPGAGLAPIPTSLQ
IEDQYPSSLAAGLSHFAVGIWRNWGRDTFIALPGCLLSTGRFQEARQIILSFAGAIRHGL
IPNLLAEGIGARYNCRDATWFWLVSIVKYVESAPNGVGILEDPVRRIYPNDDSVYGEGEV
QQMLIETIYEALDKHFAGIDYRERSAGPQIDEQMRDEGFQVTAGVSRTTGFIYGGNRWNC
GTWMDKMGSSERAGNKGEPATPRDGAAVELQGLAYRALKSLKNWKEQGVIQRSGVSDEWT
WGFWAQKIRENFEKEFFVDKDSYAEFVNRREIIKDSVGSTLGFTDFQLRCNFGIALAVAP
DLMDPKKAWKALDSAEVLLGPLGMKTLDPTDWAYNGYYNNDDDGTDKKTAKGWNYHQGPE
WLFVAGYYLQARLRIGDILGGSEKQYAIRQVQERLGNAYKHIISSPWRSLPELTNADGEY
CMQSCAAQAWSVGCLIEACVKLNTIEG
NT seq 4404 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaaaaagaaatccgaatcattgttcttgaagatggagagcacttggaaagt
gttataagaaaaattgagaaaggttggatagttcgattcaagcgcggctcttcacttctt
ggaaagaaagttaaagttttcacctctatttgccctggaaattctctggaatggtctgaa
ggaaaagaccacttggcagtttactgtcaagtggaatgcaaggaagctggatccttcaga
tattggtttaaaattgaggattctgaagagcgaggcagtggatacttcttggtgatgcca
gagctgaagatcaacggaaaatgcctgccgctcgatggaatcgcttgccaaacgtacctc
acaaagcttctaggaccgctttccgagtggaaagaacgacttgaagttgcacatcagaca
ggatataacatgatccatttgactcctatccatgagcttggaatctcaaatagtagctat
tccctcagtgatcatcattctttgattaaaaccatccagtcgcaggatcaaaagttcgga
tttgaagacgtgcaagcgctcgtgggagatcttgagcggtcctggaacatactcacagta
caggatgttgtgtggaatcacgcagcaaagaatgccacgtggcttctggagcatccagag
tctgcctataactgcttgaatagtccacatcttcggccagcatatgtaattgacagagtg
tatcacgaatttggaaagcagattggagaaggtgtgtgggaacatcgtggtgttccacca
gtcgttgacaatattcaccatgtaaatgcaatcgagtatcttctgagagcagaagttttg
ccaaaggccgatcttcacgagttttatcaagtggatttgaaggcaatggttaacctattc
gaggtgttcatcaaacaatctagtggtcccacaacgaacccgttggacggagaagatgta
gaaatcgaacaagatttagaatgtcgaagattcggaaacactgtggactttgagagatcc
gctagaattttcaatcgacaccggggagatgctaagtcagaagaagaacgagtggaaaaa
tgcgttcgaagctttgaagaagccctcaataacaaaaatctcgaagccgctcgcgagtca
tgggaagtgattttagccggcttggcagcagtgatgggaggaatcacatatgagcgaatt
gctgataacggcccgaaaaagggacttgtatctccggaaaacccgttgacaactgattat
tttctgcatttggaggcagatctcgggtggaaatcagaagagaaattcgcatatgatcca
gaaaagtcaaagtttttaatggcttttaatggatgggttatgagcagtgatccgatgaag
aattttgcgctgaaagaatctcaggtttatctccgccgtgagctcgtctgctggggtgat
tccgtaaagctaaattatggaaacaaagaagcggatagcccattcctctggcaatatatg
aaggaatacacgcaacaagccgcccgaatcttccacggtctccgcatcgacaacgctcat
ggcacgccgatccacgtggctgaaaagttactgaaaacggcaagagaagtccggccggat
atctatgttttcgcagaattgttcaccggaagtgagcatgccgacaacatgttcgtgaac
agattaggaatctcgtctttaattcgagaagctcaatcggcacatgacagtcacgagcag
ggacgattggtttatagatacggaggtgactgtgtaggggcgttcaagcaaaaatcggct
cgcctggctccaaaatcgattgctcacggcttattcttggaccaatctcatgacaatccg
tcaccaattcacactagaagcccattcgacattcttccaaccgccgccatgctcacaatg
gcttcttgtgctgtaggtagtaatcgaggttacgacgagctcattagagatcacatccac
gtggtttccgaaaaacgcccatatgcttcttggtgccgtccggatcaagtgtctagaagc
cagggaatcattgaaggccggaatttgctcaacaagcttcatacgtggctcgccgagcac
ggatattctcaagtttttgtggatcaaatgaattcggatattgtgggaatcacgcggcac
aatccacgaacccacgaaacggtcgtagtagtgtcccatacttcattttccaagaattat
atcgattggcccggcggtttgaagcatattcccattggtggagtgctggaaaacgtgatt
ttcgagatgaaattgaaaaaggttcaagaggaatggggaactgaagatccagatgttctc
ataggacttaaaaattatgagatggaaattcgagaaaatgtgaatttggacaatggaact
atgttcaaggttcatgatggatacattgagctcacgaatttcccaactggatcagttgtt
ggatttaaaattcgaccatctgatgaagcaactaaagcttttaatatgattcataactcg
attactccagaacaatctgaatttgactctgctctctctcgtctcacatatcaatcattc
ccaaatcttctattccactgtgaatccgaggactatgccacgatacaacaaggcggatac
gatgttccgaatttcggaaaattcgtctactgcggccttcagggcctcgtgccagtcctc
gaaaaaatccgcgatgataacgacctcgggcatccattgtgccaaaatctccgtgatggg
acgtggatctgcgactatattgtcggaagattggcgaaattcgagaagctcggagaagtt
tcagaggctatcagaaaattttttgcaccgttggatcatgtgccttattacctccgtccg
tgctattttgaactactcgtttcttatatttacggaaaaattcgtaaagaggcgttgaag
agaatggctccgcaaatctcctcgtcatccgcgttagtccgacacttggccatctcaact
ctctcattccttggatacattcctggagccggtctcgcaccgattccgacttccctccaa
attgaagatcagtatccatcaagtttggccgccgggctatcccactttgctgttggaatc
tggagaaattggggtcgtgacacatttatcgccttgccgggatgccttttatcaactggc
cgattccaggaagcccgtcaaatcattctctcatttgccggcgctattcgtcatggactc
ataccgaatcttctagccgagggaattggtgccagatataattgtagagatgccacgtgg
ttctggctggtttcgattgtgaaatacgtggaatcggcgccaaatggagtcgggattctt
gaggatccagtgcgcagaatctacccgaatgatgatagtgtctatggagagggagaagtg
caacagatgcttattgaaactatttatgaggcacttgacaagcatttcgctgggattgac
tacagggagagaagtgccggaccacaaatcgacgaacaaatgagagatgagggattccag
gtgaccgccggcgtctctcgcaccacaggcttcatctacggcggtaatcgctggaattgt
ggaacatggatggacaagatgggaagtagtgaaagagccggaaataaaggagaacccgcg
acgccgagagatggagcggccgtcgagctacagggacttgcctacagagcactgaaaagc
ttgaagaattggaaggagcaaggtgtgatccagagatccggagttagcgacgagtggacg
tggggcttctgggctcagaagatccgagaaaactttgagaaggagttctttgttgataaa
gattcctatgcggagtttgtaaatcgtcgggagatcatcaaggattctgtcggttccaca
ctaggattcaccgacttccagcttcgttgcaactttggaattgcattagcagttgctcca
gatcttatggatcctaagaaagcatggaaggcattggattcagctgaagttcttcttgga
ccacttggaatgaagacccttgatccaacagattgggcttacaacggctactacaacaat
gatgatgatgggactgacaagaagacggcaaaaggatggaattatcatcagggccctgaa
tggctcttcgtcgccgggtattatctccaagctcggctgagaatcggtgatatcctcgga
ggatccgaaaagcagtatgcgatccggcaagtccaggagcgactcggcaatgcttacaag
cacatcatttcatcaccatggaggtcactaccggaactgacaaatgctgatggagaatac
tgtatgcagagttgtgctgcccaggcgtggtccgtcggttgcctgattgaagcatgtgta
aaacttaatactatcgagggatga

DBGET integrated database retrieval system