KEGG   Caenorhabditis elegans (nematode): CELE_R06C1.1Help
Entry
CELE_R06C1.1      CDS       T00019                                 

Gene name
hda-3
Definition
Protein HDA-3
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    CELE_R06C1.1 (hda-3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CELE_R06C1.1 (hda-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(11913125..11913546,11913658..11913798,11914659..11914859,11915842..11916316,11917554..11917712))
Genome map
AA seq 465 aa AA seqDB search
MSLQHSKSRVSYYYDGDFGNFYYGQGHPMKPHRVRMTHSLIVNYGLYRKLNVMRPARASF
SEITRYHSDDYINFLRNVKSDNMSTFTDQMARFSVGEDCPVFDGMYEFCQLSCGGSLAAA
ARLNRQESEIAINWMGGLHHAKKSEASGFCYSNDIVLAILELLKHHKRVLYIDIDVHHGD
GVEEAFYTTDRVMTVSFHKHGEYFPGTGDLKDVGAGSGKYYALNVPLRDGVDDVTYERIF
RTIMGEVMARFQPEAVVLQCGADSLAGDRLGVFNLTTYGHGKCVEYMKSFNVPLLLVGGG
GYTIRNVSRCWLYETAIALNQEVSDDLPLHDYFDYFIPDYKLHIKPLAALSNFNTPEFID
QTIVALLENLKQLPHVPSVQMQSISTSCDSIVKTFDEKLIRDHQNDDVRVTQFEEDVQVE
DSAEFYDGQEPETKNIQSMKRHASPICAAQEEMKKNRIDGGENVA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccaacactcgaaatctcgagtttcctactattatgatggagattttggaaat
ttctactatggacaaggacatccaatgaaaccgcatcgtgttcgaatgacacatagcctt
attgttaattatggattatatcggaagcttaatgtcatgcgtcccgcccgtgcttcattc
tccgaaatcacacgttatcactctgacgactatatcaatttccttcgtaacgttaaatcc
gataatatgtccacattcacagatcaaatggcccgattctcagttggagaggattgtcct
gtctttgatggaatgtatgagttctgccagctatcatgtggtggatcactggctgctgcc
gcccggcttaatcgtcaagaatcagaaattgcaattaactggatgggtggtctacatcat
gcgaagaaatcggaagcttctggattctgttactcgaatgatattgttctggcgattttg
gagcttttgaagcatcataaaagagttctttatattgatattgatgttcatcatggtgat
ggagttgaggaagcattttatacgacagatagagttatgactgtttcatttcataaacat
ggagaatatttccctggaactggagatttaaaggacgttggcgctggaagtggcaagtac
tatgctctgaatgttccacttcgtgatggagtcgatgacgtcacttatgaacggattttc
agaacaattatgggagaagttatggcaagatttcaaccagaagcagttgtgctccaatgt
ggtgccgattcactggcaggagatcggctaggagtattcaatttgactacttatggacac
ggaaaatgcgtggaatacatgaaaagcttcaacgtgccgcttctgttagttggcggtggt
ggatatacgattcgaaatgtctccagatgttggctgtacgagacggcgatcgctttgaat
caagaagtttcagatgatctgcccctccacgactactttgactacttcatcccggactac
aaactacacataaagccgctcgccgctctttcgaacttcaacactcctgaattcattgat
caaacgattgtcgcgcttttggagaatttaaagcaacttccacacgttccatcggtccaa
atgcaatcgatttcgacgagttgtgactcaattgtgaagacttttgacgagaaactgatc
cgagatcatcagaatgatgacgtcagagttactcagttcgaggaagacgttcaggtggaa
gattcggcggaattctacgatggtcaagagccggagacgaagaatattcaatcgatgaaa
cggcacgcgagtccgatttgtgcggcgcaagaggagatgaagaaaaatcggattgatggc
ggcgaaaatgtggcataa

DBGET integrated database retrieval system