KEGG   Caenorhabditis elegans (nematode): CELE_R08F11.3Help
Entry
CELE_R08F11.3     CDS       T00019                                 

Gene name
cyp-33C8
Definition
Protein CYP-33C8
Orthology
K17955  
cytochrome P450, family 33
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Cytochrome P450 [BR:cel00199]
 Cytochrome P450, animal type
  CYP33 family
   CELE_R08F11.3 (cyp-33C8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(3800866..3801135,3801895..3802405,3802451..3802949,3803240..3803444))
Genome map
AA seq 494 aa AA seqDB search
MFFILVLVLTGISIYLFHLLYWKRRNLPPGPTPLPLFGNTLPTLFDIPGYKTFGKLKEQY
GDAYTFWMGKDPYVMICSYDLLKETFIRDADTYKDKDYNPIDEKIRGGIYGILQTNGHVW
NTHRRFALTTFRDFGLGKDLMQQKILIEVEDMFRKLDENIGEEQDVPTVLYNAVANVINQ
IIFGYRFEGVKQEEFTKLKELMEYLETAFATLKIYVEIFVPWIGKLLPGKSLDDVLNYWK
DTSYEFFNSQIENHRLKIDFDTEESLDYAEAYLKEQKKQKAQGEFELFCDKQLSNNCLDL
WTAGLSTTIITINWTICYIMNTPGVQEKMQEEMDKVVGGGRLVTTADKNDLPYMNAVINE
AQRCGNIVPLNLLHCTTKDTVINGYSVKKGTGVVAQISTVMYDEKIFPDPYTFNPDRFID
DNGKLVKIEQLIPFSIGKRQCLGEGLARMELFLFIANFLNRYHISPGSSGLPSLDKSKGI
TPRKFEPVLSRRHA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcatacttgttctagtgctaactggaatttccatctaccttttccatcttttg
tactggaaaagaagaaatttaccaccgggacctactcctctcccactgttcggcaatact
ctcccaactttgttcgatattccgggatataagacattcggaaaattgaaggagcaatat
ggagatgcatacacgttttggatgggcaaagacccatatgtcatgatttgctcctatgat
ttattgaaagaaactttcattcgagacgcagacacctacaaggacaaagactacaacccg
attgatgagaaaattcgtggaggtatctatggcatcctacagactaacgggcatgtttgg
aacacccatcgtagatttgctctcaccacttttcgggatttcggacttggaaaggatttg
atgcagcaaaaaattttgatagaagttgaagacatgttcagaaaattagatgaaaatatt
ggcgaggagcaggatgttccaacggttctgtataatgctgtggcaaatgtcattaaccaa
attatttttggatatcggtttgaaggagttaaacaggaagaattcacaaaactcaaggag
ttaatggagtacctagaaactgcatttgccacattgaagatctacgtggaaatttttgtg
ccctggattggaaaattgctccctggaaaatcgctggatgatgtgctcaactactggaag
gacacctcctatgaatttttcaattcgcaaattgaaaatcaccgtctgaaaatcgacttt
gacaccgaggaaagcttagactatgccgaagcctacctgaaagagcagaagaagcaaaag
gctcaaggagaattcgagttgttttgtgataagcaactttcgaataattgcctagattta
tggacggcaggcttatctaccactattatcacaattaactggaccatctgctacattatg
aatactccgggagttcaagaaaaaatgcaggaggaaatggataaggtggtgggaggtggt
agattggtgacaacagctgataagaatgacctaccatatatgaatgcggtgatcaatgag
gctcagagatgtgggaatattgtgccgctgaacctgttgcattgtacaacaaaggacact
gttatcaatggttattcagtgaaaaaggggactggagtcgttgcgcagatcagcacagtt
atgtatgatgagaagatcttccctgacccctatactttcaacccggatagattcatcgat
gacaatgggaagctggttaaaatcgaacaactcattccattctcaatcggaaaacggcaa
tgcctcggagaaggacttgctcgaatggagctgttccttttcattgccaactttttgaac
aggtatcacatctcaccaggatcctccggtcttccatcgctcgacaaatcgaaggggata
actccgagaaagtttgagccggttttgagcaggagacatgcctga

DBGET integrated database retrieval system