KEGG   Caenorhabditis elegans (nematode): CELE_R10E11.1Help
Entry
CELE_R10E11.1     CDS       T00019                                 

Gene name
cbp-1
Definition
Protein CBP-1, isoform B
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    CELE_R10E11.1 (cbp-1)
   04330 Notch signaling pathway
    CELE_R10E11.1 (cbp-1)
   04350 TGF-beta signaling pathway
    CELE_R10E11.1 (cbp-1)
   04630 Jak-STAT signaling pathway
    CELE_R10E11.1 (cbp-1)
   04068 FoxO signaling pathway
    CELE_R10E11.1 (cbp-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CELE_R10E11.1 (cbp-1)
Transcription factors [BR:cel03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    CELE_R10E11.1 (cbp-1)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    CELE_R10E11.1 (cbp-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(9766698..9766737,9766791..9766867,9766920..9767708,9768003..9768368,9768421..9768547,9768680..9768829,9768881..9769393,9769444..9772656,9772708..9772915,9772966..9773158,9773331..9773633,9773862..9773936)
Genome map
AA seq 2017 aa AA seqDB search
MDEPPSKKSRADSDYDSGLDALSALESLEAFPTSSKDTDVDNNPSTSAGGSGGPSGSTPH
PQGTPQPAPSNNGGFNLQPGQSQPQQPPQNMGGGVNGSVLQELLMNPSQTSNNSPRPQAY
PPGQQNAFNRSPMMPNGTPNMMSPPSMGRVPGPSPGGPQPPGPGQPQMRPGQPGMFQGDQ
QQQMMMGAQGQQFPGMMHRYPYAQGGPPPGAQGMPQGYPGVSRGGPTPGQPMGRGAMMNG
AMPRSGPMPTQGRPGIPPNQQAMMQPMMTDRQFMQHGQYGQQRPEFMQQYGRPGGYPMMH
QGMMMDSNGQPIRGPNQMMMMSNGHPGMSHGPPNGQPGPQAAAAQHAAQQQAAAQAQAQA
AAQQQQQQQREQEAAAAAQRNGAGRATTPGSSMLATHQDPEKRKLIQQQLVLLLHAHKCS
QREKENRDFAAKNQPPPHAACTLPHCSTMKEVLTHMTSCNVGRLCHSDTTQTTKKCSVAH
CASSRQIIAHWKNCSREDCPVCKPLKRIQDTPLQFSLPDLANLIGVNGNSNGSAEGDGLH
QFGSPAMRTGNITNSLFEGFNGNPFQNGPNRGGPRPPGGNGEIPNLPPPDMPDCTKEWHH
QVTKDLRNHLVGKLVKAIFPEPNQEAMNDNRLKDLIAYARKVEKEMFESANDREEYYHLL
AEKIYKIQKELQEKKNSRLNQGAAAHDQYAIPPSNELAQMLGVEGGRSDVHSEGSSMAVA
PSQQNQPWGGAPNSNMHQQIPPNGQVPQVNNSSTFPSSGNSTPNIGASSTVSAMLQPKTE
PMDDQNTDSLSSRPPTAIGFGGSSSSTPAPIMNGIVKKEEDPEESSNQAPPSVKDTKDGV
AESKPKEQQAKREPTPPPTEDTVFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNI
PDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLS
EMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAAMCTIAREQQYWVFEQSSTQYNVTVT
ERYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWH
RICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQ
AEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCF
FGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMA
HIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDD
NLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDDDDGEDADGGLGGGDSGKKKS
SKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKP
ISDPDGLMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCN
KCSSPAVWHCQSCDDFDLCDGCKPTTQHPHEMEKIKSLIGGGEAGDSAAGGTRYESIQRC
IASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTR
DACTVPFCMNIRQKLAEQKRSQQRRADMMMRRRMEGLQSHVGGAAPTPSTVSNGTPSNAP
TPPVSAGPGPAVKGGGVGQVQMQQHQGSHVGGSGPAGMGQPMNSFGGMPGMGLGPNAQNG
PGLPGMNPQMNANQSRYMPNGPGLGQSGAPGQQQQPMYSSGMPMQRPGGLGGMNPQQQPQ
QQQGHPGLQNPGGRPGGVHGMGQNQPVRNNQDMVMNMQMQNQHQQPPPFDSTLQPQIMKI
NSRLKAAKTEEERETVFSDLKKTPHLFHAWLRMRENQNLVPNRMQGYSQMSMGSSNLQNL
QQQQLQQQQAGAMRGGGGFAPGQNNSQPRAPSGQFASMNPSMQQQYPQQQQGWPQQRQQN
PGGMQQNANPYNQFQNRQNMMMMPQQQQPHPSNAGGQ
NT seq 6054 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaccaccatcaaaaaaatctcgcgctgatagcgactatgattctgggttagat
gcgctaagtgctctcgaaagtctcgaagcattcccaacttctagtaaagatacagatgta
gacaataatccaagcacatcagctggaggatccggtggtccttctggctcgacacctcat
ccacaaggcactccacaaccagcaccatcaaacaatggcgggttcaatctacaaccagga
cagtcgcaacctcagcagccgccacagaatatgggaggaggtgtcaatggatcagtgctt
caagaacttctaatgaatccatcacaaacgtcgaacaattcacctcggccgcaggcatat
ccgcctggacagcaaaatgcatttaataggagtccaatgatgccaaatggtacaccgaat
atgatgtcacctccatctatgggtcgagtgccggggcccagtcctggaggtccacaacca
ccaggcccaggccaaccacaaatgcgaccaggccaaccaggaatgttccaaggagatcag
caacagcaaatgatgatgggtgcacaaggacaacaattcccaggaatgatgcatcgatat
ccgtacgcacaaggtggtcctccaccaggagcccagggaatgcctcaaggatatccagga
gttagtcggggcggaccaactcctggacaacccatgggacgtggtgctatgatgaatgga
gcaatgccaagaagtggaccaatgccgacacaaggaagacctggaatacctccaaaccaa
caagcaatgatgcagccaatgatgactgatcggcagtttatgcaacacggacaatatggt
cagcagcgaccagaatttatgcaacaatatggtcgtcccggtggatatccaatgatgcat
caagggatgatgatggacagtaatggtcaaccgattcgaggcccgaatcaaatgatgatg
atgagcaatgggcatccaggaatgtcacacggtcctccaaatggtcaacctggaccacaa
gctgctgcagcacaacacgctgctcaacagcaagctgctgcacaagctcaagctcaggcg
gctgcacaacaacaacagcagcaacaacgagagcaagaagctgcggcggcagctcaacga
aatggtgctggaagggcgacaactcctggatcaagcatgcttgcaacgcatcaagatccc
gagaagcggaagcttattcagcaacaacttgttctattacttcatgcacacaaatgttct
caacgtgagaaggaaaatcgtgatttcgctgcgaagaatcaaccacctccacatgctgcc
tgtacattaccccattgctcaacgatgaaagaagtattgacacacatgacaagctgcaat
gttggtcgtttatgtcattccgataccacacaaactacaaaaaaatgttcagtcgctcat
tgtgcatcgtctcgccaaataatagctcactggaaaaactgctcaagggaagattgtcct
gtctgcaaaccactcaaaaggatacaagatactccattacaattttcattgcccgatctt
gcaaatctaataggagtcaacgggaattcgaacggaagcgcagaaggtgatggacttcat
cagtttggatcgccagcgatgcgaactggaaatattacaaattctctattcgaaggattc
aatggcaatccattccaaaacggaccaaatcgtggaggaccgagaccacctggtggaaat
ggagaaattccaaacttgccaccaccagatatgccagattgtacgaaagaatggcatcat
caagtcacaaaagatctcagaaatcaccttgtcggaaaattggttaaagcgattttcccg
gaaccgaatcaggaagcgatgaatgataatcggttaaaagatttgatagcctatgccaga
aaagtcgaaaaagagatgtttgaatctgcaaatgacagagaagagtattatcatttgttg
gctgagaaaatttacaagatacaaaaagagcttcaagagaaaaagaattcaagactcaat
caaggagctgctgcacatgatcaatacgcaattccaccgtcgaacgagctcgctcagatg
cttggtgtggaaggtggacgtagtgatgttcattctgaaggaagtagtatggcagttgca
ccaagtcaacaaaatcaaccatggggaggtgctccgaattccaacatgcatcagcagatt
cctccgaatggacaagttccacaggtcaataattcttcgacattcccgtcaagtggtaac
agcactccaaacatcggagcttcatctactgtcagtgctatgctgcaaccgaaaactgaa
cccatggacgatcagaatacagattcgttaagttcaagaccaccaacggctattggattc
ggtggctcgagctcatcaacgccagctccaattatgaacggaattgttaagaaggaagaa
gatcctgaagagtcttcaaatcaagctcctccatcagttaaggatactaaggatggtgta
gctgaatcgaaacctaaagagcaacaagcaaagcgagaacctaccccgccaccaactgaa
gatacagtgttcagtcaagaggatcttataaaattcttgcttcctgtatgggagaagcta
gataaatccgaagacgctgcaccattccgagttccagtcgatgcaaaacttttaaatatt
cccgattatcacgagatcatcaagcgcccaatggatttggaaaccgttcacaagaaattg
tatgcgggtcagtatcaaaacgctggtcaattctgtgatgacatttggctgatgcttgac
aatgcttggctgtataacagaaagaacagtaaagtatacaaatacggtcttaagctgtcg
gaaatgtttgtgagtgaaatggatccagtgatgaagagtatgggatactgttgtgccaag
aaacttgcattcacacctctttcattgttctgttacggtgcagcaatgtgcacgatagcc
agagaacagcaatactgggtattcgaacaaagttctacgcagtacaatgtgacagttacg
gagagatatacttattgtcagaaatgtttcgatgctcttcctcctgaaggaatatcactt
tccgaaaatcccaacgatcgaaacaacatggcaccgaaaacatcgtttacggaacagaag
aacagtgttattgattatgagcctttcgagagatgtaaatattgtatgaggaaatggcat
cggatatgtgcacttcatgataagaaagtttatccagaaggatttatatgcgaatgttgc
cggactgctaagaaatatcaaaagccagataacaagtatcttgctagcaaattgccacat
aataagctgtctacattcctcgaagatcgtgtcaacggtttcataaagaagcagttacaa
gcagaagctcacaagtatccagtcatcattcgaacactatgtgtacaggataaagaagca
gaagtcaaagcgcagatgaaacagaagtacgtggagagcaatcaattccctgaaaagttc
ccctatcgcacaaaggcagtttttgccttcgagatcattgatggagtcgaagtgtgtttc
tttggtcttcacgtacaggagtacggtagtgcatgtcctgctccaaatgctcgacgtgtc
tacattgcctatctcgattctgttcacttcttccagccaagggagctgagaaccgatgtg
tatcacgaacttcttttgggttatttggattacgcgaagatgctgggctacacaatggct
catatttgggcgtgtccaccatcagaaggagatgactacatcttccactgccatccacca
gagcaaaagattccaaagccgaagcgtctccaggattggtacaaaaagatgttggagaag
ggagtgcaggagggaagtgtcgttgaatttaaggatatatacaagcaagcaagagatgat
aatctgacaactccaactcagttgccttatttcgaaggagatttctggccgaatgtgatt
gaagattgtatacgtgaagcatcgaacgaggaagctcagagaaaagtgaaagaagatgat
gatgatggtgaagatgcggatggtgggctcggaggtggtgatagcggcaagaagaagagc
tcgaaaaacaaaaagaataacttgaagaagaatgccaaaatgaataagaagaaggctgga
agtattactggaaacgaagttgctgacaagctttactcgcaattcgagaagcacaaagaa
gtattcttcacgattcgtctggtcagtcttcagaatgagccagccgtgctcgcaaagcct
atcagcgatccagatggtttgatgcaatcagatatgatggatgggcgtgatacgttcctc
acaaaagcaagagaagagcattgggagttttcttcattgagaagagcaaagtattcaaca
ctttgtcttgcatattctcttcatgaaaccgattccaaaggaatggagtacacctgtaac
aagtgtagcagtcctgctgtctggcattgccaaagctgtgatgactttgatctttgcgat
ggctgcaagccaacaacacaacatcctcatgaaatggagaagatcaagtcacttatcggc
ggtggagaagctggtgatagcgctgctggtggaacacgatatgaaagtatacaacgatgc
atcgcttcactggttcatgcttgccaatgccgtgatgctaactgccgtcgtatgtcgtgt
cacaagatgaagcgtgttgttcaacacacgaaaatgtgcaagaagaggatcaatggaact
tgtccagtatgcaagcaactcatagcattgtgctgctatcatgccaaacattgtactcga
gatgcttgtacggttccattctgtatgaacattcgtcagaagctcgccgagcagaagcga
tcgcaacaacgaagagctgatatgatgatgagacgaagaatggaagggcttcaatcccat
gttggtggagcggctccaactccgagtacagtatctaatggaactcccagtaatgcgcca
acaccacctgtaagtgctggacctggtcccgctgtgaaaggaggtggagttggacaagta
caaatgcaacaacatcaaggaagtcatgtgggtggatcagggcctgcaggaatgggacaa
ccaatgaacagttttggtggaatgcctggaatgggtcttggtccaaacgcgcaaaatggg
cctggattgcctgggatgaacccacaaatgaacgcgaatcagagtcgatatatgcctaat
ggaccaggattgggtcagtctggagctccgggacaacaacagcagccaatgtattcttct
ggtatgccaatgcaacgtccaggtggacttggtggaatgaatcctcaacaacaaccacaa
caacaacaaggtcatcctggacttcaaaatccaggtggtcgtcctgggggagttcatgga
atgggtcaaaatcagccagtcagaaataaccaagatatggtaatgaacatgcaaatgcaa
aatcaacaccaacagccaccacctttcgattccacattgcaaccgcaaataatgaagatc
aattctcgactgaaggcagcgaaaacggaggaagaacgggaaactgtattttcagacctt
aagaagactccacatttgttccatgcttggcttaggatgcgggaaaatcaaaatttggtg
cctaatcgaatgcaaggatattcgcaaatgtcaatgggttcttcgaatcttcaaaacttg
cagcagcagcagcttcaacaacagcaagccggtgcgatgcgtggtggtggaggatttgcc
cctggacaaaacaattctcaacctcgtgcaccaagtggccagtttgcatcgatgaatcca
tcaatgcagcagcagtatcctcagcaacaacagggatggcctcaacagcggcagcagaat
cctggtgggatgcagcaaaatgctaatccgtacaatcagttccaaaatcggcaaaatatg
atgatgatgccacaacaacaacagcctcatccatctaacgctggcggtcaataa

DBGET integrated database retrieval system