KEGG   Caenorhabditis elegans (nematode): CELE_R10E11.3Help
Entry
CELE_R10E11.3     CDS       T00019                                 

Gene name
usp-46
Definition
Protein USP-46, isoform A
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(9776552..9776644,9776693..9776795,9776854..9776976,9777036..9777478,9777724..9777903,9778192..9778530)
Genome map
AA seq 426 aa AA seqDB search
MGATGSSQLEKEISTTESVNNANEHYYGLVNFGNTCYCNSVIQALFFCRPFREKVLNYKQ
TLKKSGASKDNLVTCLADLFHSIASQKRRVGTIAPKRFITKLKKENELFDNYMQQDAHEF
FNYLINTISETLIQEKIAEREKASRHGTLKKGNVTVNLAPATAGLPRSDEKGTSERNGGI
TVEGNEFLNKSDTTTWIHEIFQGILTNETRCLSCETVSSKDEDFLDLSIDVEQNTSISHC
LRVFSETETLCGDQKYFCETCSSKQEAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLS
YRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDI
VEKLEVSSMEEFSGMSTDANIQMPPGNQSAPQKNSESAYILFYQARDYAADDPNHNHKGK
NSTHSV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggagctactggatcatcacaactggaaaaggagatcagtaccactgagtcagttaat
aatgccaatgaacactattacgggctagtaaattttggaaatacatgttactgcaactca
gtgattcaggcgttgttcttctgccggccgtttcgagaaaaagttctcaattacaagcaa
actttgaagaaatcgggcgcttcaaaggacaacttggttacgtgtctagctgatctattt
catagtattgccagtcaaaaacgaagagtaggaacaattgctccaaaacgatttattact
aaattaaagaaagaaaatgagctcttcgacaactacatgcaacaagacgctcacgaattt
ttcaattatctcattaatacaatatcggagacactaattcaagagaaaatcgcagaacga
gagaaagcgtctcgccacggaacactcaaaaaaggaaatgtcacagttaatttggcacct
gccactgcgggtcttccacgatcagatgaaaaaggaacgagtgaacgaaatggtggaatt
acggtggaaggcaacgagtttttgaataaatctgacactactacgtggattcatgaaata
tttcaaggaattttgacaaatgagacgaggtgtttgagttgtgaaactgtgtcaagtaaa
gatgaagattttctggatttatcgattgatgtggaacagaatacttcaattagccattgt
ctacgggtatttagtgaaacggagacactttgtggtgatcagaaatatttctgcgaaacg
tgctcgtcgaaacaggaagctcaaaagcgaatgcgaatcaagaaacctcctcaactgctg
gctctccatctgaaacgatttaaattcgtcgaacctctgaatcgacacacaaagctttct
tatcgagttgtatttccactggaattgcggctattcaatgtgagcgatgatgctgaatac
ggtgatcggatgtatgacctggtcgcaacagtggttcattgtggagctactccaaatcga
ggtcattatatcactttggtgaagagcaattcgttttggctggtatttgatgatgatatt
gttgaaaaactggaagtttcatcaatggaagagttctctggaatgtccacggatgcaaat
attcaaatgccacctggaaatcaatcagctcctcaaaagaattccgaatctgcctatatt
ctgttctatcaggcaagagactacgctgctgatgatccaaatcataatcataaaggaaaa
aatagtacacactccgtctag

DBGET integrated database retrieval system