KEGG   Caenorhabditis elegans (nematode): CELE_R10E11.3Help
Entry
CELE_R10E11.3     CDS       T00019                                 

Gene name
usp-46
Definition
Protein USP-46, isoform A
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_R10E11.3 (usp-46)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_R10E11.3 (usp-46)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(9776638..9776730,9776779..9776881,9776940..9777062,9777122..9777564,9777810..9777989,9778278..9778616)
Genome map
AA seq 426 aa AA seqDB search
MGATGSSQLEKEISTTESVNNANEHYYGLVNFGNTCYCNSVIQALFFCRPFREKVLNYKQ
TLKKSGASKDNLVTCLADLFHSIASQKRRVGTIAPKRFITKLKKENELFDNYMQQDAHEF
FNYLINTISETLIQEKIAEREKASRHGTLKKGNVTVNLAPATAGLPRSDEKGTSERNGGI
TVEGNEFLNKSDTTTWIHEIFQGILTNETRCLSCETVSSKDEDFLDLSIDVEQNTSISHC
LRVFSETETLCGDQKYFCETCSSKQEAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLS
YRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDI
VEKLEVSSMEEFSGMSTDANIQMPPGNQSAPQKNSESAYILFYQARDYAADDPNHNHKGK
NSTHSV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggagctactggatcatcacaactggaaaaggagatcagtaccactgagtcagttaat
aatgccaatgaacactattacgggctagtaaattttggaaatacatgttactgcaactca
gtgattcaggcgttgttcttctgccggccgtttcgagaaaaagttctcaattacaagcaa
actttgaagaaatcgggcgcttcaaaggacaacttggttacgtgtctagctgatctattt
catagtattgccagtcaaaaacgaagagtaggaacaattgctccaaaacgatttattact
aaattaaagaaagaaaatgagctcttcgacaactacatgcaacaagacgctcacgaattt
ttcaattatctcattaatacaatatcggagacactaattcaagagaaaatcgcagaacga
gagaaagcgtctcgccacggaacactcaaaaaaggaaatgtcacagttaatttggcacct
gccactgcgggtcttccacgatcagatgaaaaaggaacgagtgaacgaaatggtggaatt
acggtggaaggcaacgagtttttgaataaatctgacactactacgtggattcatgaaata
tttcaaggaattttgacaaatgagacgaggtgtttgagttgtgaaactgtgtcaagtaaa
gatgaagattttctggatttatcgattgatgtggaacagaatacttcaattagccattgt
ctacgggtatttagtgaaacggagacactttgtggtgatcagaaatatttctgcgaaacg
tgctcgtcgaaacaggaagctcaaaagcgaatgcgaatcaagaaacctcctcaactgctg
gctctccatctgaaacgatttaaattcgtcgaacctctgaatcgacacacaaagctttct
tatcgagttgtatttccactggaattgcggctattcaatgtgagcgatgatgctgaatac
ggtgatcggatgtatgacctggtcgcaacagtggttcattgtggagctactccaaatcga
ggtcattatatcactttggtgaagagcaattcgttttggctggtatttgatgatgatatt
gttgaaaaactggaagtttcatcaatggaagagttctctggaatgtccacggatgcaaat
attcaaatgccacctggaaatcaatcagctcctcaaaagaattccgaatctgcctatatt
ctgttctatcaggcaagagactacgctgctgatgatccaaatcataatcataaaggaaaa
aatagtacacactccgtctag

DBGET integrated database retrieval system