KEGG   Caenorhabditis elegans (nematode): CELE_R11F4.1Help
Entry
CELE_R11F4.1      CDS       T00019                                 

Gene name
R11F4.1
Definition
Protein R11F4.1
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CELE_R11F4.1 (R11F4.1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CELE_R11F4.1 (R11F4.1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_R11F4.1 (R11F4.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(4092014..4092106,4092169..4092331,4092389..4092503,4092893..4093931,4093986..4094084)
Genome map
AA seq 502 aa AA seqDB search
MVLLAAIDQGTSSSRFLVFEADTGELVTSHQIEVRQLFPHGGWVEMDPMELYDTVVSCIS
KTIEKLENLGISADEIKSVGVANQRETSIVWDKETGKPLYNAIVWLDTRTSSLADEAISR
TASKSKDEFRAKTGLPIHPYFSALKLKWLFQNVPEVKKAYADGNLMFGTVDTWLIWKLTG
AYVTDVSNASRTLLLDLHKRKWSTQLCEFFDLPIEILPEIRSSAEVYGHFDKGPLEGVPL
SGCLGDQQAAMVGHQCLNAGQTKNTYGTGTFMLCNIGTRPIISKNGLLTTVGFQFGADSP
VVYALEGSGSIGGNVVRFLRDNFKFISDAKEMEGLCRSVEDTSGAYFVPSFTGLYTPYWD
STARGTILGLTQVTQREHICLAALRAVAFQSAEMIAAVEQDLEGGTKVTTLKVDGGMIAN
KLFNEIQADIMGRDIVTPKITEISGWGAAVAGGIGAQQISLDEFLQQSSEDNRYTPQKDD
NWRSAELARWKEAVKRSCGWAQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggttctgttggctgcaatcgaccaaggcacctcttctagccgcttcctcgtttttgag
gcagacaccggagagcttgtcactagtcatcagatcgaggtccgtcaactctttccccat
ggtggatgggtcgaaatggatcctatggagctctacgataccgtagtctcctgtatctcc
aaaaccatcgaaaagctcgaaaacctcggaatctcggccgacgagatcaagtcggtgggc
gtcgctaatcagcgagagacaagcattgtttgggacaaggaaaccggaaaaccactgtac
aatgcgatcgtgtggcttgacactagaacctcctccctcgcagatgaagctatctcgaga
actgcttccaaatccaaagacgaattccgcgccaaaactggtctccccatccatccatac
ttcagtgctctcaagctcaaatggctcttccagaacgttccagaagtgaaaaaggcctac
gctgacggtaatctcatgttcggaaccgttgacacttggctcatctggaagcttaccggt
gcttacgtgacagatgtctcgaatgcgtcgagaactttactcctggatttgcacaaacga
aaatggtccactcaactgtgcgagttcttcgatctcccaatcgaaatccttccggagatt
cgatccagcgccgaggtttatgggcattttgacaaggggcctttggaaggagttccactt
tccggatgccttggagatcagcaagctgcgatggttggacatcagtgcctgaatgctggc
cagacaaagaacacctatggaactggaacttttatgctttgtaatattggaactcgaccg
atcatctcaaaaaacggcttgctaactacagtaggcttccaatttggtgctgactctcca
gttgtctacgctctcgaaggatccgggtcgattggcgggaatgttgtcagattcctcaga
gataatttcaagtttatctctgacgcgaaagaaatggaagggctttgcagaagtgtggaa
gacacctccggagcctactttgtcccatcattcaccggattatacactccgtactgggac
tcgacagctcgaggaaccattctcggactcacccaggtcacccaacgcgagcacatctgt
ctagctgctctgcgagccgttgctttccaaagtgctgagatgattgctgcagttgaacag
gatctcgaaggaggtaccaaggttacaactctgaaagtcgatggaggaatgatcgctaac
aagctgttcaatgagattcaagcggatattatgggacgggatattgtgactccaaagatt
accgagatttccggatggggagcagcggttgccggtggaatcggagctcagcagatcagt
ttggacgagtttttacagcagtctagtgaggataatcgatacactccacaaaaagacgat
aactggaggtctgcagaacttgctcgctggaaagaagccgtcaaacggtcgtgtggatgg
gctcaatga

DBGET integrated database retrieval system