KEGG   Caenorhabditis elegans (nematode): CELE_R12A1.4Help
Entry
CELE_R12A1.4      CDS       T00019                                 

Gene name
ges-1
Definition
Protein GES-1
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    CELE_R12A1.4 (ges-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CELE_R12A1.4 (ges-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(1427707..1427807,1427872..1427981,1428751..1428883,1428924..1429065,1429186..1429418,1430083..1430595,1431615..1431909,1431976..1432137))
Genome map
AA seq 562 aa AA seqDB search
MRIFLVSVILINACWAGPIVETNYGKVEGIEYEGAEVFLAIPFAKPPVDDLRFEKPVAPD
PWEDVYPATQYRNDCTPHYRLVAQFSSYSGEDCLTLNIIKPKKAEKLPVLFWIHGGGYEI
GSASQHGYEFFAKRYASQGVIVATVQYRLGFMGFFSEGTSDVQGNWGLFDQAAALEFVKS
NIENFGGDPNQITIWGYSAGAASVSQLTMSPYTRDSYSKAIIMSASSFVGWATGPNVVET
SKQLAEILGCPWPGAKECMKKKSLHEIFDAIEVQGWTTGTIDILRWSPVIDGDFMTKNPE
ELIKESPVKPTLIGMSNKEGSYFAALNMGRVIADFGLSPEDMPKVDEEFISEIIGRKLLY
NNRYGENREKVWNDILDFYVKQGKPAEVKDLNGFYVDRYSELLSDITFNVPILREITSRV
ERKTPVWTYRMDHYDKNIWKKHIPEQARGSPHANEYHYLFDMPVMAKIDMKKEPDSWIQN
DLIDMVISFAKTGVPQIEDVEWRPVSDPDDVNFLNIRSDGVSIEHGLFQEPLAFWNELRQ
REGFDLIDPTNSAMHSSNKDEL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcggatattccttgtctctgtaatactaataaatgcctgctgggctggaccaattgtt
gaaacaaactacggaaaagtggagggaatagaatatgaaggagccgaagtttttctcgca
attccgtttgccaagccaccagtcgatgatttgagatttgagaagccagtcgcccctgat
ccatgggaagatgtctacccagcaacccaataccgaaacgattgcactcctcactatcgt
ttagtcgctcaattctctagctattccggtgaagattgtctcacactgaatatcattaag
cccaaaaaggctgaaaagctgccagttctgttctggattcacgggggtggatatgaaatc
ggttcggctagtcaacatggttacgagtttttcgccaagaggtatgcttcacaaggagtt
attgtggctacagttcagtatcggcttggattcatgggattcttcagcgaaggaacatct
gatgttcaaggaaactggggcctttttgatcaagctgccgctctggaatttgttaaatca
aatatagaaaattttggtggtgacccgaatcagataacaatttggggatacagtgcagga
gcagcaagtgtctctcagctcactatgagcccgtatactagagattcatactcgaaggct
attatcatgtcggccagctcttttgtcggatgggccaccggtccaaacgtcgtggaaact
tcgaagcaactcgcagaaatattggggtgtccatggcctggagcaaaggagtgcatgaag
aaaaaatcgctccatgaaatttttgacgcaattgaagttcagggatggacaactgggaca
atcgatattttgagatggtcccctgtaattgatggagattttatgacaaagaatcctgaa
gagcttatcaaggagtctccagtaaagccaacattgattggaatgagcaacaaggaaggg
tcgtattttgccgctttgaatatgggacgagtgattgccgatttcggattgtcaccagaa
gatatgccaaaagtagatgaagaattcatttcggagatcatcggaagaaaacttctctat
aataacagatatggagaaaatcgcgaaaaagtttggaacgatattctagacttttacgtt
aagcagggaaaaccggcagaagtgaaggatctcaatgggttctatgtggatcgatattca
gagctgctctcggatatcaccttcaacgtgccaattcttcgtgaaatcactagcagagtt
gagagaaaaactccagtttggacataccgtatggatcactacgataaaaatatttggaaa
aagcatattccagagcaagcaagaggctctccgcatgctaatgaataccattatctattt
gatatgccagtgatggcaaaaattgatatgaagaaagaaccggacagttggattcaaaat
gatctgattgatatggtgatttcatttgctaaaaccggagttccccaaatagaagatgta
gaatggagaccagttagcgatccagacgacgtaaactttttgaatatcagatctgatggg
gtctcaattgagcatggtcttttccaagaacctctcgctttctggaacgaactgcgccaa
cgagaaggatttgatttaattgatccaactaatagtgccatgcattcgtcaaacaaggac
gagctgtaa

DBGET integrated database retrieval system