KEGG   Caenorhabditis elegans (nematode): CELE_T01C8.1Help
Entry
CELE_T01C8.1      CDS       T00019                                 

Gene name
aak-2
Definition
Protein AAK-2, isoform B
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CELE_T01C8.1 (aak-2)
   04150 mTOR signaling pathway
    CELE_T01C8.1 (aak-2)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    CELE_T01C8.1 (aak-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CELE_T01C8.1 (aak-2)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   CELE_T01C8.1 (aak-2)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    CELE_T01C8.1 (aak-2)
  Mitophagy factors
   Other mitophagy factors
    CELE_T01C8.1 (aak-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(16796016..16796158,16799634..16799797,16799973..16800441,16800616..16800734,16800960..16801065,16801155..16801260,16801310..16801517,16801619..16801930,16802341..16802492,16802676..16802777)
Genome map
AA seq 626 aa AA seqDB search
MFSHQDRDRDRKEDGGGDGTEMKSKSRSQPSGLNRVKNLSRKLSAKSRKERKDRDSTDNS
SKMSSPGGETSTKQQQELKAQIKIGHYILKETLGVGTFGKVKVGIHETTQYKVAVKILNR
QKIKSLDVVGKIRREIQNLSLFRHPHIIRLYQVISTPSDIFMIMEHVSGGELFDYIVKHG
RLKTAEARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDEQNNVKIADFGLSNIMTDGDF
LRTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPSLFRKIKSG
VFPTPDFLERPIVNLLHHMLCVDPMKRATIKDVIAHEWFQKDLPNYLFPPINESEASIVD
IEAVREVTEFQRYHVAEEEVTSALLGDDPHHHLSIAYNLIVDNKRIADETAKLSIEEFYQ
VTPNKGPGPVHRHPERIAASVSSKITPTLDNTEASGANRNKRAKWHLGIRSQSRPEDIMF
EVFRAMKQLDMEWKVLNPYHVIVRRKPDAPAADPPKMSLQLYQVDQRSYLLDFKSLADEE
SGSASASSSRHASMSMPQKPAGIRGTRTSSMPQAMSMEASIEKMEVHDFSDMSCDVTPPP
SPGGAKLSQTMQFFEICAALIGTLAR
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcatcaagatcgagaccgcgataggaaggaggacggtggtggagacggtact
gagatgaaatccaagagtcggagtcagccaagtggacttaatcgcgtgaaaaatctttca
agaaagctatcggcaaagtcaagaaaggaacgcaaggaccgcgatagcacagacaacagt
tcgaaaatgtcgtctccaggaggagaaacgtcgacgaagcagcaacaagagctcaaagct
caaatcaaaatcggacattacattctcaaggagacactcggagttggtacttttggtaaa
gtaaaagttggaatccatgagacaactcaatacaaagtggctgtcaagattctgaaccgt
cagaagatcaagtcactggatgtcgttggaaagattcgccgcgaaatccaaaacctctcg
ctcttccgccatccgcatatcatccgcctctaccaagtcatcagtacaccttctgacatt
ttcatgattatggagcacgtttccggcggggagctctttgactacattgttaagcacgga
cggctgaagaccgcagaagctcgtcgcttctttcaacaaatcatttccggcgttgactac
tgtcatcgtcatatggttgtccatagagatttgaagccagagaatttgttgctcgatgag
cagaacaatgtgaagattgcggactttggactttcaaatattatgacggatggtgacttc
ttacgcaccagctgcggatcgccaaattatgctgcccctgaggttattagcggaaagttg
tacgcaggtcccgaagttgatgtatggtcgtgtggagtcattttgtatgcacttctttgt
ggaaccctgccatttgatgatgagcacgtgccaagtcttttcagaaaaattaaatctggc
gtattcccaactccagactttctggagcgcccaattgtaaatctgcttcaccatatgctc
tgcgtagacccgatgaagagggccaccatcaaggacgtcattgctcacgagtggttccag
aaggatttgccgaactacttgttcccaccaatcaacgagagtgaggcttccattgttgat
attgaggctgtccgagaggtcactgagtttcagcgctatcatgtcgccgaagaggaagtc
acctcagcattgctgggagatgatccacatcaccatttgtcgattgcatataacttgatt
gttgataacaagagaattgccgatgagactgccaagttgtcaattgaggagttttatcaa
gtgacgccgaataagggacctggaccagttcatcgccatccagagcgcattgcagcgtca
gtcagcagcaagatcacaccaactctcgacaacacggaagccagtggcgcgaaccgcaac
aaacgtgccaagtggcatctgggtatccgatcccaaagtcgtccggaagacatcatgttc
gaggtgttccgtgcgatgaagcagctggacatggagtggaaggtgctcaacccatatcat
gtgattgttcgtcgcaagcctgatgcacccgctgccgacccgccaaagatgtcgttgcag
ttgtaccaagtggatcagagaagttacttgttggatttcaagagtttggccgacgaggag
tctggatccgccagtgcatcttcatcccgacacgcatcaatgtctatgccgcagaagccg
gccggaattcgtggaactagaacgtcaagcatgccacaggcgatgagtatggaggcgagt
attgagaaaatggaagtgcatgatttttcggacatgtcgtgcgatgtgacaccaccacca
tctcctggaggagctaagctttcccagactatgcaattctttgagatttgcgccgcattg
attggaacactggctcgttaa

DBGET integrated database retrieval system