KEGG   Caenorhabditis elegans (nematode): CELE_T01E8.3Help
Entry
CELE_T01E8.3      CDS       T00019                                 

Gene name
plc-3
Definition
Protein PLC-3
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CELE_T01E8.3 (plc-3)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    CELE_T01E8.3 (plc-3)
   04020 Calcium signaling pathway
    CELE_T01E8.3 (plc-3)
   04070 Phosphatidylinositol signaling system
    CELE_T01E8.3 (plc-3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CELE_T01E8.3 (plc-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(10222878..10223173,10223222..10223406,10223459..10223609,10223656..10224129,10224182..10224267,10224319..10224687,10224763..10225191,10225289..10225987,10227265..10227405,10227696..10228334,10228398..10228690,10228733..10228923,10228968..10229067)
Genome map
AA seq 1350 aa AA seqDB search
MQHGSLGPSSSSRKTTVTSTAGSVHLHHRSSNGFSTASRAQLNRHNEMDFGKMFAAMEKG
HKVCKIAVLKKWDPAYKQLTLDRYSRQIFLTKLELSAVRNKPTILDIRQIREVQTLNYKL
NTIKVDDKWKKDREIVNFDSKAILIISYGMGFALSYWILLFESEDACKLWSQGLHNLMMD
TRDRDSSPHPLRIERFLHKHFLSLMSPANDAVARKHMKPFVQTSLQFKVQSDQLQQVTED
QMNSDQFSFASRQLIHVPELFSSRFADLAEKHERKGLVVTFQNFLRFLDGKQFDELASNR
TRALEFLNRYFQEDQAYFGDRNEPSMTVFEFCDFLFSRENSLWDPTNEKVTHDMSRPLSH
YWIASSHNTYLTGDQLRSESSLDCYAQALLMGCRCIELDCWDGQKKPGSAEFIDIVIYHG
YTMTSKILLRDVLHVIRHYAFVTSEYPVILSIEDNCSVPAQRLLAQELKDILGDYLLTQP
ANREEKQLPSPAALKKKIIVKHKKLPIESEDLAAVVKTDEFQDTEIISRECVKKGILMVK
NNNSHEWTSHVFILFPDRLCYLIQTADPENPNDDTVSVSGDEEREEETPSGFGVKPEEMH
VTEEWFHGRCERDEAKKRILEHKEKGNGLFMIRDSNLFIGDFSLSILHDGKVHHVRIRSK
IIDKEKKYYFMDNKVCDTLYELVSYYTRHYLTTAHFKMVLTIPCPQPQPHLNQPWFSATA
DKEKAEELLSLVPEDGAFLIRTSSTDSSVYVLSLKVDGEFWHYRLKRDGRIFVVNQKVFE
NLNQIVEFYANREFVRGISLRFPVNEKDISHLTAELAEARTPGCYMDLKDLDKEVQARAL
RPYRGTADDELSFPANVIITVLRKEEGLWRGRYGSLTGWFPSAHVQEILPEKVSTSETSN
YNTIELAGTLIERIHDADRPNVIRISQSNQHWMNKQYYLLAASSSEEADGWQNNLFELTR
SVNTKMSILRTKEKEKRIAAELSNLVVYCQAVPFDPAHIYNDAFYEMCSFVEGKLDKLVE
KGLLPFNSRKLSRVYPNGSRITSNNYSPVPMWNAGCHMVALNYQTGDKPMQLNQGKFLAN
GRCGYLLKPDYMLTDDFDPTNTEKFATAYPIRLNVQVIGGRHLSRKDKNKGICSPFVEIE
IIGMPCDTKVFQTKTIASNGLNPIWNQTFTFEIQCPEVALIRFHVEDGDFVGPKTDPFIG
QAVFPVDSIRCGFRSVPLKNQYSEELELSSLLVDVQMCSREGTQLIRSSSHFLQASRLAP
VFAHRKITNGDSIPREMAPRLRTSATDRSLDSPTNSESRATLLSGQRGSQDSMDSAAETS
SIASGTISSRDGKKKQNWLKKFSFGKSSKS
NT seq 4053 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacggctcacttggcccatcatcgtcgtctcgaaagactacagtaaccagcaca
gcgggctccgttcaccttcatcaccgctcttcaaatggtttctcgacagcatcacgagct
caattgaaccgtcacaatgaaatggattttgggaaaatgtttgcggcaatggagaaaggt
cacaaagtgtgcaaaattgcggtgttgaagaaatgggatccagcctataaacaattaacg
ttggatcggtactcgaggcagatttttctgacaaaattggaactgtcagctgttagaaat
aaaccgacaattctagatattcgacaaatccgtgaagtacagacattgaattacaaattg
aacacaattaaagtagatgataaatggaaaaaggatcgagaaatcgtaaattttgattca
aaagccattctaatcatctcatatggaatgggatttgctctttcctattggattcttttg
tttgaaagtgaggatgcgtgcaaattatggtcacaaggacttcataatttgatgatggac
acaagagatcgagactcatcccctcatccattgagaattgaacgatttctgcataaacac
tttttgagtttaatgtcaccggctaatgatgccgttgctcgaaagcatatgaaaccattt
gttcaaacctccctccaattcaaagttcaatctgatcagctccaacaagtgacagaagat
caaatgaattctgatcaattcagttttgccagtcgtcaacttatccatgtacctgaactc
ttctcttcaagattcgctgatcttgctgaaaaacatgaacgaaaaggtcttgtggtgacg
tttcaaaattttttgcgatttcttgatggcaaacaattcgatgaacttgcctcgaatcga
acgagagctttggagtttttgaatcgatattttcaagaagatcaagcatattttggagat
agaaatgagccttcaatgactgttttcgagttttgtgattttttattttcaagggagaat
tcgctgtgggacccaacaaatgagaaagttactcatgatatgagcagaccattgtctcat
tattggattgccagctcgcataatacatacttgacgggtgaccaacttcgatctgaatct
tctttggattgttatgctcaagctcttttgatgggttgtagatgcattgagttagattgc
tgggatggacagaagaagcccgggtcagccgagttcattgatattgtcatctatcacggg
tatacgatgacctcaaaaattttgctccgcgacgtgcttcacgtcatccgtcactatgca
tttgttacgagtgaatatccagtaattctatcaattgaggacaactgctcggtgccagct
caacggcttctagctcaagaactgaaagatattcttggtgattatttattgacacaacca
gcaaatcgtgaagaaaaacaattgccctccccggccgcgttgaagaagaaaattatcgtg
aagcataagaagttgccgatagaaagcgaggatttggcagctgtggtgaaaactgatgag
ttccaagacacggaaatcatatctcgcgaatgtgtaaagaaggggatcctgatggtaaaa
aacaacaacagtcacgaatggacatctcatgttttcatattattccctgatcgtctttgc
tacctgattcaaaccgctgatcctgaaaatccaaatgacgatacagtgagtgtaagtgga
gatgaagaacgggaagaagagacgccttctggatttggagtgaaacctgaagaaatgcat
gtgactgaagaatggttccatggaagatgtgaacgggatgaagcgaaaaaacggattcta
gagcataaggagaagggaaatggattgtttatgattcgagattcgaatctgttcattgga
gatttctcactttcgattctacatgacgggaaagttcatcatgttcggataagatccaag
attattgataaagagaaaaaatattacttcatggataacaaagtctgcgacactctttac
gagttggtctcttactacacccgtcactacctcacaactgctcatttcaaaatggtgctc
acgattccatgtcctcaaccacaaccgcatcttaatcagccatggttctctgctactgct
gacaaggaaaaagccgaagaacttttgagcttggtgccagaagatggtgctttcctaatt
cggacgtcatcgactgactcttcagtttacgttctttcgctaaaagtcgacggcgaattc
tggcattatcgattgaaaagagatggaagaattttcgtggtgaatcaaaaagtattcgag
aatttgaatcaaattgttgaattctatgcgaatcgagaatttgttagaggaattagtctt
cgattccctgtcaatgagaaggatatatcacacctgacagctgaacttgcagaagctcgt
actccaggttgctatatggatctgaaggatttggataaagaagttcaagctcgagcactt
cgaccgtatcgaggaacagctgatgatgaactttcgttcccagcgaatgttattatcaca
gtactccggaaggaagaaggtctttggagaggaagatatggatcgttgactggatggttc
ccttcggcccatgtacaagagattctaccagagaaagtttcaacttcagaaactagcaac
tacaacacaatcgagctagctggaacactaattgaacggattcatgatgctgatcgtccg
aatgttatcagaatatcacaatcaaatcaacattggatgaacaagcaatattatttgttg
gctgcttcttcctccgaggaagcagatggttggcaaaacaatctcttcgagctgactcgt
tcagttaacacaaaaatgagcatactccgaaccaaagaaaaagaaaaacgaattgccgct
gagctctcaaatctagtcgtctactgtcaagctgttccattcgacccagcccatatctac
aatgacgctttctatgaaatgtgctcatttgtcgagggaaaacttgacaaactggttgaa
aaggggcttcttccgtttaattcccgaaaactctcgagggtctatccgaacggaagtcga
atcacatcgaataattatagtccggttccaatgtggaatgcaggatgtcatatggttgca
ctaaactatcaaaccggtgataaacccatgcagttgaatcaaggaaagtttttggcaaat
ggaagatgcgggtacctactgaaaccagattatatgttaactgatgacttcgatcctacg
aacacggaaaagtttgcaacagcttatcccattcgactgaatgttcaagtgattggagga
cgtcatttgtcaagaaaagataagaataaaggaatatgctccccatttgtggaaattgaa
attattggaatgccatgtgacacaaaagtttttcaaactaaaactatagcatcaaacggt
cttaatccgatctggaatcaaactttcacatttgagatccagtgtcccgaagtagcactg
atcagattccacgtggaagacggtgactttgtgggaccaaaaacagatccgttcattggt
caagcagtattccctgttgattcaattagatgtggattccgatcagttccactcaaaaat
cagtacagtgaggagcttgagctctcttcactgttagttgatgtacaaatgtgctccaga
gaaggaactcaattgatcaggtcgtcgtcgcatttcttgcaggcgagtcgtctggctcct
gtcttcgctcaccgtaagatcacaaatggcgatagtatccctcgtgagatggcacctcgg
ttacgaacatcagccaccgatcgttcactagactctccaacaaattccgagtcaagagcc
actcttctgagcggccaacgaggtagccaagactctatggacagcgctgccgaaacatcg
tccattgcatctggaacaataagctctcgggatggaaagaagaaacaaaactggctcaag
aagttctcatttggaaaaagtagtaaatcatag

DBGET integrated database retrieval system