KEGG   Caenorhabditis elegans (nematode): CELE_T01E8.3Help
Entry
CELE_T01E8.3      CDS       T00019                                 

Gene name
plc-3
Definition
Protein PLC-3
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cel00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cel04012]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cel04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cel04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(10222818..10223113,10223162..10223346,10223399..10223549,10223596..10224069,10224122..10224207,10224259..10224627,10224703..10225131,10225229..10225927,10227205..10227345,10227636..10228274,10228338..10228630,10228673..10228863,10228908..10229007)
Genome map
AA seq 1350 aa AA seqDB search
MQHGSLGPSSSSRKTTVTSTAGSVHLHHRSSNGFSTASRAQLNRHNEMDFGKMFAAMEKG
HKVCKIAVLKKWDPAYKQLTLDRYSRQIFLTKLELSAVRNKPTILDIRQIREVQTLNYKL
NTIKVDDKWKKDREIVNFDSKAILIISYGMGFALSYWILLFESEDACKLWSQGLHNLMMD
TRDRDSSPHPLRIERFLHKHFLSLMSPANDAVARKHMKPFVQTSLQFKVQSDQLQQVTED
QMNSDQFSFASRQLIHVPELFSSRFADLAEKHERKGLVVTFQNFLRFLDGKQFDELASNR
TRALEFLNRYFQEDQAYFGDRNEPSMTVFEFCDFLFSRENSLWDPTNEKVTHDMSRPLSH
YWIASSHNTYLTGDQLRSESSLDCYAQALLMGCRCIELDCWDGQKKPGSAEFIDIVIYHG
YTMTSKILLRDVLHVIRHYAFVTSEYPVILSIEDNCSVPAQRLLAQELKDILGDYLLTQP
ANREEKQLPSPAALKKKIIVKHKKLPIESEDLAAVVKTDEFQDTEIISRECVKKGILMVK
NNNSHEWTSHVFILFPDRLCYLIQTADPENPNDDTVSVSGDEEREEETPSGFGVKPEEMH
VTEEWFHGRCERDEAKKRILEHKEKGNGLFMIRDSNLFIGDFSLSILHDGKVHHVRIRSK
IIDKEKKYYFMDNKVCDTLYELVSYYTRHYLTTAHFKMVLTIPCPQPQPHLNQPWFSATA
DKEKAEELLSLVPEDGAFLIRTSSTDSSVYVLSLKVDGEFWHYRLKRDGRIFVVNQKVFE
NLNQIVEFYANREFVRGISLRFPVNEKDISHLTAELAEARTPGCYMDLKDLDKEVQARAL
RPYRGTADDELSFPANVIITVLRKEEGLWRGRYGSLTGWFPSAHVQEILPEKVSTSETSN
YNTIELAGTLIERIHDADRPNVIRISQSNQHWMNKQYYLLAASSSEEADGWQNNLFELTR
SVNTKMSILRTKEKEKRIAAELSNLVVYCQAVPFDPAHIYNDAFYEMCSFVEGKLDKLVE
KGLLPFNSRKLSRVYPNGSRITSNNYSPVPMWNAGCHMVALNYQTGDKPMQLNQGKFLAN
GRCGYLLKPDYMLTDDFDPTNTEKFATAYPIRLNVQVIGGRHLSRKDKNKGICSPFVEIE
IIGMPCDTKVFQTKTIASNGLNPIWNQTFTFEIQCPEVALIRFHVEDGDFVGPKTDPFIG
QAVFPVDSIRCGFRSVPLKNQYSEELELSSLLVDVQMCSREGTQLIRSSSHFLQASRLAP
VFAHRKITNGDSIPREMAPRLRTSATDRSLDSPTNSESRATLLSGQRGSQDSMDSAAETS
SIASGTISSRDGKKKQNWLKKFSFGKSSKS
NT seq 4053 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacggctcacttggcccatcatcgtcgtctcgaaagactacagtaaccagcaca
gcgggctccgttcaccttcatcaccgctcttcaaatggtttctcgacagcatcacgagct
caattgaaccgtcacaatgaaatggattttgggaaaatgtttgcggcaatggagaaaggt
cacaaagtgtgcaaaattgcggtgttgaagaaatgggatccagcctataaacaattaacg
ttggatcggtactcgaggcagatttttctgacaaaattggaactgtcagctgttagaaat
aaaccgacaattctagatattcgacaaatccgtgaagtacagacattgaattacaaattg
aacacaattaaagtagatgataaatggaaaaaggatcgagaaatcgtaaattttgattca
aaagccattctaatcatctcatatggaatgggatttgctctttcctattggattcttttg
tttgaaagtgaggatgcgtgcaaattatggtcacaaggacttcataatttgatgatggac
acaagagatcgagactcatcccctcatccattgagaattgaacgatttctgcataaacac
tttttgagtttaatgtcaccggctaatgatgccgttgctcgaaagcatatgaaaccattt
gttcaaacctccctccaattcaaagttcaatctgatcagctccaacaagtgacagaagat
caaatgaattctgatcaattcagttttgccagtcgtcaacttatccatgtacctgaactc
ttctcttcaagattcgctgatcttgctgaaaaacatgaacgaaaaggtcttgtggtgacg
tttcaaaattttttgcgatttcttgatggcaaacaattcgatgaacttgcctcgaatcga
acgagagctttggagtttttgaatcgatattttcaagaagatcaagcatattttggagat
agaaatgagccttcaatgactgttttcgagttttgtgattttttattttcaagggagaat
tcgctgtgggacccaacaaatgagaaagttactcatgatatgagcagaccattgtctcat
tattggattgccagctcgcataatacatacttgacgggtgaccaacttcgatctgaatct
tctttggattgttatgctcaagctcttttgatgggttgtagatgcattgagttagattgc
tgggatggacagaagaagcccgggtcagccgagttcattgatattgtcatctatcacggg
tatacgatgacctcaaaaattttgctccgcgacgtgcttcacgtcatccgtcactatgca
tttgttacgagtgaatatccagtaattctatcaattgaggacaactgctcggtgccagct
caacggcttctagctcaagaactgaaagatattcttggtgattatttattgacacaacca
gcaaatcgtgaagaaaaacaattgccctccccggccgcgttgaagaagaaaattatcgtg
aagcataagaagttgccgatagaaagcgaggatttggcagctgtggtgaaaactgatgag
ttccaagacacggaaatcatatctcgcgaatgtgtaaagaaggggatcctgatggtaaaa
aacaacaacagtcacgaatggacatctcatgttttcatattattccctgatcgtctttgc
tacctgattcaaaccgctgatcctgaaaatccaaatgacgatacagtgagtgtaagtgga
gatgaagaacgggaagaagagacgccttctggatttggagtgaaacctgaagaaatgcat
gtgactgaagaatggttccatggaagatgtgaacgggatgaagcgaaaaaacggattcta
gagcataaggagaagggaaatggattgtttatgattcgagattcgaatctgttcattgga
gatttctcactttcgattctacatgacgggaaagttcatcatgttcggataagatccaag
attattgataaagagaaaaaatattacttcatggataacaaagtctgcgacactctttac
gagttggtctcttactacacccgtcactacctcacaactgctcatttcaaaatggtgctc
acgattccatgtcctcaaccacaaccgcatcttaatcagccatggttctctgctactgct
gacaaggaaaaagccgaagaacttttgagcttggtgccagaagatggtgctttcctaatt
cggacgtcatcgactgactcttcagtttacgttctttcgctaaaagtcgacggcgaattc
tggcattatcgattgaaaagagatggaagaattttcgtggtgaatcaaaaagtattcgag
aatttgaatcaaattgttgaattctatgcgaatcgagaatttgttagaggaattagtctt
cgattccctgtcaatgagaaggatatatcacacctgacagctgaacttgcagaagctcgt
actccaggttgctatatggatctgaaggatttggataaagaagttcaagctcgagcactt
cgaccgtatcgaggaacagctgatgatgaactttcgttcccagcgaatgttattatcaca
gtactccggaaggaagaaggtctttggagaggaagatatggatcgttgactggatggttc
ccttcggcccatgtacaagagattctaccagagaaagtttcaacttcagaaactagcaac
tacaacacaatcgagctagctggaacactaattgaacggattcatgatgctgatcgtccg
aatgttatcagaatatcacaatcaaatcaacattggatgaacaagcaatattatttgttg
gctgcttcttcctccgaggaagcagatggttggcaaaacaatctcttcgagctgactcgt
tcagttaacacaaaaatgagcatactccgaaccaaagaaaaagaaaaacgaattgccgct
gagctctcaaatctagtcgtctactgtcaagctgttccattcgacccagcccatatctac
aatgacgctttctatgaaatgtgctcatttgtcgagggaaaacttgacaaactggttgaa
aaggggcttcttccgtttaattcccgaaaactctcgagggtctatccgaacggaagtcga
atcacatcgaataattatagtccggttccaatgtggaatgcaggatgtcatatggttgca
ctaaactatcaaaccggtgataaacccatgcagttgaatcaaggaaagtttttggcaaat
ggaagatgcgggtacctactgaaaccagattatatgttaactgatgacttcgatcctacg
aacacggaaaagtttgcaacagcttatcccattcgactgaatgttcaagtgattggagga
cgtcatttgtcaagaaaagataagaataaaggaatatgctccccatttgtggaaattgaa
attattggaatgccatgtgacacaaaagtttttcaaactaaaactatagcatcaaacggt
cttaatccgatctggaatcaaactttcacatttgagatccagtgtcccgaagtagcactg
atcagattccacgtggaagacggtgactttgtgggaccaaaaacagatccgttcattggt
caagcagtattccctgttgattcaattagatgtggattccgatcagttccactcaaaaat
cagtacagtgaggagcttgagctctcttcactgttagttgatgtacaaatgtgctccaga
gaaggaactcaattgatcaggtcgtcgtcgcatttcttgcaggcgagtcgtctggctcct
gtcttcgctcaccgtaagatcacaaatggcgatagtatccctcgtgagatggcacctcgg
ttacgaacatcagccaccgatcgttcactagactctccaacaaattccgagtcaagagcc
actcttctgagcggccaacgaggtagccaagactctatggacagcgctgccgaaacatcg
tccattgcatctggaacaataagctctcgggatggaaagaagaaacaaaactggctcaag
aagttctcatttggaaaaagtagtaaatcatag

DBGET integrated database retrieval system