KEGG   Caenorhabditis elegans (nematode): CELE_T02B11.7Help
Entry
CELE_T02B11.7     CDS       T00019                                 

Gene name
nas-32
Definition
Protein NAS-32
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_T02B11.7 (nas-32)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_T02B11.7 (nas-32)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(894930..895032,895114..895306,895412..895530,895780..895904,895952..896184,896232..896356,897236..897438,897496..897579,897642..897861,898235..898458,898616..898873,899064..899132))
Genome map
AA seq 651 aa AA seqDB search
MRRFFICYIGFLSIFLDFILADKDNNSEEERDRKFDWKFENENGKPEHETVTVPKLPDGS
YFWKWTWNSRINSTTAATPTSTVTTSTSAPTTSPRVYKLKSEARKSLRKALRGVPPEKRK
KQLKKMGKKMMKIPKITKKESNKLHKSYRKVKITENPPALDMFEVNERAGLNEYLFQGDI
NLNNNQIAKISSEQSSKSRRKKRQIDNLAQFWPGKVVYYYFDSGLTTTVQQIVRDAITFL
ESNTCLKFELNSTATNRIFSGVGCYSDTGMLGGEQTLSLGYGCEVTGTAAHEIAHTLGLF
HTQMRSDRDDYVTIDLTDVPESSQQNFIKLTEATSTNLVDYEYGSFMHYSGRAFVSSGGV
DSIVPKDPVMVYTMGGRIVTFLDLKMLNTHYSCSCPTILSCGNGGFTNPANCSVCICPYG
FGGALCTERTDYGCGSTLTATDTWQQETYTFGNASNSATARPSAVYCNHWIQAPVGKQIQ
FRIDSTYNTQCVYGCTFNGVEPKLKSDMTITQARYCCDEFNAEIMTADFGVNPMPVFSFN
RYYKTTYTWSYRYVDSNVTACADTSDKATCLSLKSAKEQGCSIYDTAQLKVMCAATMDLC
GKVASDDGTCKDRFPKSQCSTYSTNGMCTQQPPLAAEFSCAETCGFCTNPV
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgattttttatttgttatatcggttttttgagtatttttctagattttatttta
gctgataaggacaacaacagtgaagaagaacgagatcgaaaattcgactggaaattcgaa
aatgagaacggaaagcctgaacatgagacagtaacggtacccaagctgcccgacgggtcg
tacttttggaaatggacttggaattcgagaatcaactccacgacggccgctactccaaca
agtactgtaactacatccactagtgcacctacaacgtctccacgagtttacaagttaaag
tcagaagctaggaagtcgttgaggaaggccctccgcggagtccctccagaaaaacgaaag
aagcagctaaagaaaatgggaaagaagatgatgaaaattccaaaaattaccaaaaaggaa
tcgaataaacttcacaaatcgtatcgaaaagtgaagataaccgagaatccaccagcattg
gacatgttcgaagtcaatgaacgggccggattgaatgagtatttgtttcaaggagacatc
aatttgaataacaaccaaatcgcgaaaatttcctctgaacagtcctcaaaatcccgacga
aaaaagcgtcaaatcgataacttggctcaattctggcccggaaaagttgtgtactattat
ttcgattcgggtcttacgacgacagttcagcaaattgtgcgtgatgcgataacgttcttg
gaatcgaatacatgcttgaaattcgaattgaatagcacggccacaaatcgaattttcagc
ggtgttggatgctactcagacaccggaatgctcggaggggagcaaaccttatcactgggc
tacgggtgtgaagtgaccggcacggcggctcacgagatagcccacactttggggctattt
cacacccagatgagatccgatcgtgatgattatgtcaccattgatcttaccgatgttccg
gagtcttctcaacaaaactttattaaattgactgaagcgacatcgacaaacctcgttgat
tatgaatatggaagcttcatgcattattcgggaagagcgtttgtctcatccggcggagtt
gattccatagtgcccaaagatccggtgatggtatacaccatgggcggacgaattgtgact
tttctggacttgaaaatgctcaacacgcattactcttgctcttgcccaacaattctcagc
tgtggaaatggcggcttcacgaaccctgcaaactgttccgtttgcatttgcccgtacggt
tttggtggagccttgtgcactgaaagaacagattacggatgtggaagcactttgactgca
actgacacgtggcagcaggagacgtatacatttgggaatgcgtcaaattccgccacagcg
agaccaagcgcagtttactgtaatcattggattcaggcgcctgtcggtaagcaaattcaa
tttcgaatcgattccacgtacaacacccaatgtgtctacgggtgcacatttaatggagtt
gaaccgaagttgaaaagtgacatgacaattacgcaggcgaggtactgttgcgacgagttc
aacgctgagatcatgactgccgacttcggtgtcaatccgatgcccgtcttcagctttaat
cggtactacaaaaccacgtacacatggtcatatcgatacgtggactctaacgtcaccgca
tgtgctgatacatccgacaaagccacgtgtctttctttgaaaagtgcaaaagagcagggt
tgctcaatttatgacactgctcagctgaaggtgatgtgtgcggcgactatggatttgtgt
gggaaggtggcgtcagatgatgggacatgtaaggacaggtttcccaagagccaatgctct
acctactccacgaacggaatgtgcacccaacaaccgccacttgccgccgaattctcatgc
gctgaaacttgcggtttctgtactaatccggtttga

DBGET integrated database retrieval system