KEGG   Caenorhabditis elegans (nematode): CELE_T02B11.7Help
Entry
CELE_T02B11.7     CDS       T00019                                 

Gene name
nas-32
Definition
Protein NAS-32
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(894931..895033,895115..895307,895413..895531,895781..895905,895953..896185,896233..896357,897237..897439,897497..897580,897643..897862,898236..898459,898617..898874,899065..899133))
Genome map
AA seq 651 aa AA seqDB search
MRRFFICYIGFLSIFLDFILADKDNNSEEERDRKFDWKFENENGKPEHETVTVPKLPDGS
YFWKWTWNSRINSTTAATPTSTVTTSTSAPTTSPRVYKLKSEARKSLRKALRGVPPEKRK
KQLKKMGKKMMKIPKITKKESNKLHKSYRKVKITENPPALDMFEVNERAGLNEYLFQGDI
NLNNNQIAKISSEQSSKSRRKKRQIDNLAQFWPGKVVYYYFDSGLTTTVQQIVRDAITFL
ESNTCLKFELNSTATNRIFSGVGCYSDTGMLGGEQTLSLGYGCEVTGTAAHEIAHTLGLF
HTQMRSDRDDYVTIDLTDVPESSQQNFIKLTEATSTNLVDYEYGSFMHYSGRAFVSSGGV
DSIVPKDPVMVYTMGGRIVTFLDLKMLNTHYSCSCPTILSCGNGGFTNPANCSVCICPYG
FGGALCTERTDYGCGSTLTATDTWQQETYTFGNASNSATARPSAVYCNHWIQAPVGKQIQ
FRIDSTYNTQCVYGCTFNGVEPKLKSDMTITQARYCCDEFNAEIMTADFGVNPMPVFSFN
RYYKTTYTWSYRYVDSNVTACADTSDKATCLSLKSAKEQGCSIYDTAQLKVMCAATMDLC
GKVASDDGTCKDRFPKSQCSTYSTNGMCTQQPPLAAEFSCAETCGFCTNPV
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgattttttatttgttatatcggttttttgagtatttttctagattttatttta
gctgataaggacaacaacagtgaagaagaacgagatcgaaaattcgactggaaattcgaa
aatgagaacggaaagcctgaacatgagacagtaacggtacccaagctgcccgacgggtcg
tacttttggaaatggacttggaattcgagaatcaactccacgacggccgctactccaaca
agtactgtaactacatccactagtgcacctacaacgtctccacgagtttacaagttaaag
tcagaagctaggaagtcgttgaggaaggccctccgcggagtccctccagaaaaacgaaag
aagcagctaaagaaaatgggaaagaagatgatgaaaattccaaaaattaccaaaaaggaa
tcgaataaacttcacaaatcgtatcgaaaagtgaagataaccgagaatccaccagcattg
gacatgttcgaagtcaatgaacgggccggattgaatgagtatttgtttcaaggagacatc
aatttgaataacaaccaaatcgcgaaaatttcctctgaacagtcctcaaaatcccgacga
aaaaagcgtcaaatcgataacttggctcaattctggcccggaaaagttgtgtactattat
ttcgattcgggtcttacgacgacagttcagcaaattgtgcgtgatgcgataacgttcttg
gaatcgaatacatgcttgaaattcgaattgaatagcacggccacaaatcgaattttcagc
ggtgttggatgctactcagacaccggaatgctcggaggggagcaaaccttatcactgggc
tacgggtgtgaagtgaccggcacggcggctcacgagatagcccacactttggggctattt
cacacccagatgagatccgatcgtgatgattatgtcaccattgatcttaccgatgttccg
gagtcttctcaacaaaactttattaaattgactgaagcgacatcgacaaacctcgttgat
tatgaatatggaagcttcatgcattattcgggaagagcgtttgtctcatccggcggagtt
gattccatagtgcccaaagatccggtgatggtatacaccatgggcggacgaattgtgact
tttctggacttgaaaatgctcaacacgcattactcttgctcttgcccaacaattctcagc
tgtggaaatggcggcttcacgaaccctgcaaactgttccgtttgcatttgcccgtacggt
tttggtggagccttgtgcactgaaagaacagattacggatgtggaagcactttgactgca
actgacacgtggcagcaggagacgtatacatttgggaatgcgtcaaattccgccacagcg
agaccaagcgcagtttactgtaatcattggattcaggcgcctgtcggtaagcaaattcaa
tttcgaatcgattccacgtacaacacccaatgtgtctacgggtgcacatttaatggagtt
gaaccgaagttgaaaagtgacatgacaattacgcaggcgaggtactgttgcgacgagttc
aacgctgagatcatgactgccgacttcggtgtcaatccgatgcccgtcttcagctttaat
cggtactacaaaaccacgtacacatggtcatatcgatacgtggactctaacgtcaccgca
tgtgctgatacatccgacaaagccacgtgtctttctttgaaaagtgcaaaagagcagggt
tgctcaatttatgacactgctcagctgaaggtgatgtgtgcggcgactatggatttgtgt
gggaaggtggcgtcagatgatgggacatgtaaggacaggtttcccaagagccaatgctct
acctactccacgaacggaatgtgcacccaacaaccgccacttgccgccgaattctcatgc
gctgaaacttgcggtttctgtactaatccggtttga

DBGET integrated database retrieval system