KEGG   Caenorhabditis elegans (nematode): CELE_T03F1.8Help
Entry
CELE_T03F1.8      CDS       T00019                                 

Gene name
guk-1
Definition
Protein GUK-1, isoform A
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CELE_T03F1.8 (guk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CELE_T03F1.8 (guk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:complement(join(3859687..3859802,3859869..3860092,3860155..3860293,3860470..3860586,3862501..3862555))
Genome map
AA seq 216 aa AA seqDB search
MHATSRVAWFWRPSCQSFIRKMPCRPIVLSGPSGGGKSTILTRAMQEYPNSFAFSVSHTT
RQPRAGEEHGKHYYFTEKEKMQEMIKNNEFLEFATFSGNTYGTSKKTVLEIENSGKICVL
DIELQGVRNIKNSHLDARYILIRAPSIKLLEERLRARGTETEESLSKRLQHASEDLVEIE
KNPTLFDKVIVNDDLERAYKEFVDLLRDDLEKTSKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccacctcccgtgtcgcctggttttggcggccgtcctgtcaatcgtttattcga
aaaatgccgtgccggccgattgtgctctccggaccatcgggtggaggaaaaagtacgatt
ttgacgagagccatgcaggaatacccaaatagctttgctttcagcgtttctcacacaacg
agacagccaagagccggtgaggagcacggaaaacactattacttcacggaaaaggagaag
atgcaggaaatgattaaaaataacgagtttctggagttcgccacgtttagcggaaatact
tatggaactagcaagaaaaccgtcctagaaatcgaaaatagcggaaagatctgcgttctg
gatattgagttgcaaggagttcgaaacatcaagaatagtcatctcgacgccagatacatt
ctgatccgtgccccatccatcaagcttctcgaggaaagactcagagcaagaggaaccgaa
accgaggagagcctctcgaagcgtcttcaacatgcatctgaggatttagttgaaatcgaa
aaaaatccaacgctcttcgacaaagtgattgtgaacgatgatttggaacgtgcctataag
gaattcgtcgatcttcttcgtgatgatctcgaaaaaacctccaaaaaataa

DBGET integrated database retrieval system