KEGG   Caenorhabditis elegans (nematode): CELE_T04A8.7Help
Entry
CELE_T04A8.7      CDS       T00019                                 

Gene name
T04A8.7
Definition
(RefSeq) T04A8.7, isoform A
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CELE_T04A8.7 (T04A8.7)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CELE_T04A8.7 (T04A8.7)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_T04A8.7 (T04A8.7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
III:join(4695371..4695623,4695754..4696435,4696483..4696598,4696654..4697136,4697200..4697542,4697591..4697759)
Genome map
AA seq 681 aa AA seqDB search
MVNTRPPKIDELLKIDPYLHDFQDEISRRYGVFLDYQRRIEECGGMEEFTSSYKQFGLNV
QPDNSVKGLEWAPAAEKLALIGDFNNWDQNANVYKKEEHGKWSITVPAKEDGSCPIPHNS
VIKIAVSRHGATHFKLSPWATFVTCPNPKETVIYHQNFWNPPEKYQLKEARPARPASLRI
YEAHVGISSSEGKINTYREFADDVLPRIQKQGYNAIQLMAVMEHVYYASFGYQVSNFFAV
SSRCGTPEDLKYLVDKAHSLGIFMLLDVVHSHASKNVEDGLNQWDGSNGGYFHDNARGYH
NLWDSRLFDYTQTETLRFLLSNVRWWVEEYGFDGFRFDGVSSMIYHSHGMNDDFCGGYPM
YFGLNADTDSLVYLMLANDFLHKKYPFMITIAEEVSGMPGICRPVEEGGQGFDYRLAMAL
PDMWIKILKHTSDEDWKIDDIVFNLENRRYAEKHVAYAESHDQALVGDKTIAFWLMDKEM
YDFMSTDSPLTPIIDRGLSLHKLIRLITIGLGGEAWLNFIGNEFGHPEWLDFPRVGNGES
FHYARRQFNLVDAEYLRYKFLNNWDREMMLLEERTGFLHKGYAYTSWKHDGDKTIVFERG
GLVFVINLHPTKSFADYSIGVNTPGRYRIALNSDESKFGGHNRIDNSIKFHTTDDGYAGR
RHRLQVYITCRTAIVLEKEDD
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacacacgcccaccaaaaatagatgaattgctgaaaatcgatccatatttgcac
gatttccaagatgagatttcgagaagatacggtgtctttcttgattatcaacgccgtatc
gaagaatgtggtggcatggaagaatttacaagctcgtacaaacaattcggtctgaatgtg
caaccagacaattcagtgaaaggccttgaatgggctccagcagccgaaaaattggcattg
attggagatttcaataattgggatcagaatgccaatgtgtacaaaaaggaggagcatggc
aaatggagtattactgttcctgcaaaagaagacggatcctgtcccattcctcataactcg
gtgattaaaatcgcagtttctcggcatggagcaactcacttcaaattgagcccatgggca
acttttgtgacatgcccaaatccaaaagaaacggtcatctaccatcaaaacttttggaat
ccacctgagaagtatcaactgaaagaagctcgcccagctcgtccggcgtcccttagaatc
tacgaggctcacgttggaatcagtagctcagagggaaaaattaacacatatcgtgaattc
gctgacgatgtcttgccgagaatacaaaagcaaggatacaatgcaattcagttgatggca
gtgatggagcacgtttattatgcatcatttggatatcaggtttcgaactttttcgctgtt
tccagtcgctgtggaacaccagaagatttgaaatatttggttgataaggctcattcgtta
ggaatcttcatgcttcttgatgttgttcattcccatgcttccaaaaatgtggaggatggt
ctcaatcagtgggatggatcaaatggcggatatttccatgataatgcacgtggatatcat
aatctctgggattccagacttttcgattatactcaaactgaaactcttcgtttcttgctc
tccaatgttcgttggtgggttgaggagtatgggtttgatggattccgattcgatggtgtt
tcctcaatgatttatcattcccatggaatgaatgatgacttctgtgggggatatcccatg
tactttggtcttaatgctgatacggactcgctcgtttatttgatgcttgctaatgacttc
cttcacaaaaagtatccattcatgatcacaattgctgaagaagtttctggaatgccagga
atatgtcgccctgttgaagaaggaggtcagggattcgattaccgtttggcgatggctctc
cccgacatgtggatcaagattttgaagcacacatctgatgaagattggaaaattgatgat
attgtgttcaacttggaaaataggcgctatgctgagaaacatgttgcatatgctgaatca
cacgaccaagctctcgtaggagacaagacaattgcattttggttgatggataaggaaatg
tacgacttcatgtctacagactcacctcttactccaattatcgacagaggattgtccctt
cacaagttgatccgtcttattactattggattaggcggagaagcatggctcaatttcatt
ggtaacgaattcggacatcctgaatggctcgatttcccacgcgtcggaaacggagaatca
ttccattatgctcgtcgtcagttcaatcttgtcgatgccgaatatcttcgttacaaattc
ctgaacaattgggatcgtgaaatgatgctgctagaggagcgtactggattccttcacaag
ggatacgcttacacatcatggaagcacgacggagacaaaactattgtctttgagagaggt
ggcttggtatttgtgatcaacttgcatccaactaaaagttttgctgactactcgattgga
gttaatactcctggaagataccgaatcgctcttaattctgatgagtcaaagtttggaggc
cacaaccgtatcgacaactccatcaaattccacaccactgatgatggatacgctggtaga
cgtcatcgtcttcaagtttacatcacatgccgcaccgccatcgtactcgagaaggaggat
gattag

DBGET integrated database retrieval system