KEGG   Caenorhabditis elegans (nematode): CELE_T04C10.1Help
Entry
CELE_T04C10.1     CDS       T00019                                 

Gene name
mbk-1
Definition
Protein MBK-1
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CELE_T04C10.1 (mbk-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CELE_T04C10.1 (mbk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(14820025..14820102,14820194..14820473,14820668..14820978,14821059..14821867,14821929..14822125,14822173..14822352,14822407..14822582,14822630..14822733,14822803..14822872,14822924..14823022,14824190..14824534))
Genome map
AA seq 882 aa AA seqDB search
MNTADVPDNLQSWGQQPSSSYSNTQQHSQMTNLPPINHNNLCDTEPMNEDFQLQDVQADE
LQKQQKQQEQQHIQQQNAQRFIAQSRQPHSNILRFPQPPITSIKTNSHAFYPQQEVTQVR
PKKHRVSMTNAEAALTPGMPPEKQAAKKRNIGQFSTDTVPAGIGMIGIPFESTSKPLQIQ
QFRNPQDAPVRKLTSDLIKTYKAINESFYLRKQVRRDRHKSQDAGKPKGSKDGSGASLTD
TFSIHNAIPITSSDNHYQQDAHQNAPPLLDTNAPPTSTMVVPMRTETDLQQQQRQKSSRG
GPYNNGYDDQNYDYILKNGEIFDKRYVILSDTPVGKGSFGQVTKAYDTLNKEEVAIKIIK
NKKTFFDQAQIEIHLLELTNAHDKDNKYNIVTLKGHFVHRAHLCLVFELLSYNLYDLLKN
TSFRGVSLNLARKFAQQLGKTLLFLSSPELSIIHCDLKPENVLLVNAKRSQIRVIDFGSS
CQTGHRIYQYIQSRFYRSPEVLLGIAYDTKIDMWSLGCILVEMHTGEPLFAGSSEVDQMM
KIVEVLGMPPKEMLDIGPKTHKYFDKTEDGIYYCKKTRDGYRHTYKAPGARKLHEILGVT
SGGPGGRRLGEPGHSVEDYSKFKDLIKRMLQFDPKQRISPYYVVRHPFLKQKEERVPSQP
PVSHSNLQQQQQLYIQQPSSQMSQVMESPSVGSVYVEDNGMYRQAPGSSANPISVTSSFD
EGDAMEVDAGRRRFSAHQQNYHNPNYQYSQPQQQQQQQYQQTQRTQLEQQQKQAQLQQQL
QQQQMQQQQQQQQQRQHMPQAQSSSQQHLQSRARPRQQDQNEWRNQFELDDTFQQKQRKV
DDSVSNQISRNQFNPQQVSMTHGNVNANNREMEKLDYPNNKL
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcagacgtgcctgacaatcttcaatcatggggccaacaaccatcatcaagt
tactcaaatacccagcaacactcacaaatgactaatcttccgcctatcaatcacaataat
ctttgcgacaccgaaccgatgaacgaggactttcaacttcaagacgtgcaagctgacgaa
cttcagaagcagcaaaaacagcaagagcagcaacacattcaacagcaaaatgcacaacgt
ttcattgcacaaagccgtcaaccacattccaacattctgagattcccacagccaccaatc
acttcaattaagacgaattcacacgctttctatccacagcaagaggtcacccaagtccgg
ccaaagaagcatcgcgtatccatgactaatgcagaagcggcactaactcccggaatgcct
ccggaaaaacaagccgcaaagaagagaaatattggccagttctcgacagatactgttccg
gctggaattggaatgattggtatcccgtttgaatctacctcaaagccactccaaattcaa
caattccgaaatcctcaagacgcgccagtcagaaaactaaccagtgatctcatcaaaact
tacaaggctatcaatgagtctttctacctacggaaacaggttcgacgtgatcgtcacaag
agtcaagatgccggaaagccaaagggatccaaggatggttccggggcgagcctgactgac
acattctccattcacaatgcgattccaattacgagttctgataatcattatcagcaagat
gctcatcaaaatgctcctcctctacttgacactaatgctccgcccacctcaacaatggtt
gttcctatgcgcacagagactgatcttcaacagcagcagcgacagaaaagtagtcgtggc
ggtccgtacaataacgggtatgacgatcagaattacgactatattcttaaaaatggagag
atatttgacaagagatacgtgattctcagtgacacgccggttggcaaaggatctttcggg
caagttacaaaagcttacgacacgctgaataaagaagaagtcgctattaaaattatcaag
aataagaagactttcttcgatcaagctcagattgagattcatcttttagaattgacaaat
gcacatgacaaggataataagtataatattgttacgctcaaagggcactttgtgcatcgg
gctcatctttgcttggtattcgagcttctctcctacaacctctatgatcttttgaagaac
accagtttccgtggcgtttcgttgaatttggcacgcaaatttgcccagcaattaggaaaa
actcttctcttcctgtcatctccagaattatcgattatccattgtgatttgaagccggaa
aatgtgctactagttaacgcgaagcggtctcaaattcgtgtgatagattttggatcttct
tgtcagactggacaccgaatctaccagtacattcagtcgagattctatcgttcgccggaa
gtgctgctcggcatcgcgtacgacacgaaaattgatatgtggtccctgggatgcattctc
gtcgaaatgcacaccggagagccgctgtttgccgggtcatcggaggttgaccaaatgatg
aaaattgtggaagttcttggtatgccaccaaaagagatgttagacattggcccgaaaaca
cacaagtattttgacaaaactgaggatgggatctactattgtaagaagactcgtgacgga
taccgccatacctacaaagctcctggagccaggaaacttcacgaaattctgggtgtgact
tctggcgggcccggaggtcgccggcttggagagccaggacattctgttgaagattacagc
aaattcaaagacttaataaagagaatgttgcaatttgaccccaaacaaagaatttcgccc
tattatgtggttcggcatccgttcttgaagcagaaggaagagcgagttccatctcaaccg
ccggtgtctcactcgaaccttcagcaacaacagcaattgtacatacagcagccgtcaagc
caaatgagtcaagtgatggaatctccgtcggttggatcagtctatgtggaagataacggg
atgtatcgccaggcgcctggatcttctgccaacccaatttccgtcacatcatcgtttgac
gaaggagatgccatggaagttgatgctgggagaagacgcttctctgctcatcagcaaaat
taccacaatccaaactatcagtactctcaaccacaacagcaacagcagcagcagtatcag
cagacacagcgaacgcaactggagcagcagcagaaacaggctcaactccaacagcagctc
cagcaacagcaaatgcagcaacagcagcaacagcaacaacaacgccagcacatgccacaa
gcgcagagcagttcccaacagcacctccaatcacgggcgcggccacgacaacaggatcag
aacgagtggaggaatcagtttgagctggatgacacgtttcagcagaagcagcgaaaagtt
gatgactctgtatcgaatcagatttctagaaatcaattcaatccacaacaggtatcgatg
acgcatggaaatgtaaatgctaacaaccgagagatggagaaactcgattacccgaacaac
aaactctga

DBGET integrated database retrieval system