KEGG   Caenorhabditis elegans (nematode): CELE_T04G9.2Help
Entry
CELE_T04G9.2      CDS       T00019                                 

Gene name
nas-15
Definition
Protein NAS-15
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(777733..777837,777909..778073,778120..778268,778480..778616,778665..779033,779091..779267,779320..779451,779509..779626,779706..779843,780009..780234)
Genome map
AA seq 571 aa AA seqDB search
MREYVLIFLVAPVFAAILGPYDIPPELPPLNDENFFDRSHSEYETVLTPEDFELGTRITA
AMAHDNGDDIWDSDAMYSKDRFEGDIANDNLNASTAELFANGGSGKSEDGKWYNAIKNRL
QLWPEGRIPYTISSQYSSYSRSLIAASMQEYASHTCIRWVPKEAADVNYVHIYPDRGCYS
MVGKMGGKQSLSLGSGCIQKGIILHELMHAVGFFHEQSRTDRDDHITIMWNNIQAGMQGQ
FEKYGHGTIQSLGTGYDYGSIMHYGTKAFSRNGQPTMIPKKNGATIGQRNGFSKVDKFKI
NTLYGCPVEGEKPTTSAPTSGPIVITVKPVVITTGKPPVIQTVSPAVPLKPSECRNLRGD
CDDLAKQGWCIRNPGWMRANCPISCGMCIPTKETQKPYVQTTTQAATTTARPQKPVTQPI
QPLPPVPPLPPTTPEDCEDLRVDCLVLVSQRYCKISQNFMKSYCAKSCGFCFKPPPTEIP
DNRPTVVTTRPLVTLPPAVIRSRSPAPPVSTTTKAAPTTSTTSAAPYSPTPLPSECSDRK
HFCSHWKSAGFCEGIFMNYMKKNCPASCGLC
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatacgtgctgatatttctagtagccccagtttttgcagccatcttgggtcca
tatgatattccaccagagctgccacctctgaacgatgaaaacttttttgaccgttcccac
tctgaatatgaaactgtgctcaccccagaagactttgagctcggaactcgcatcaccgct
gcaatggctcacgacaacggcgacgacatctgggattcggatgccatgtacagcaaagac
agatttgaaggagatatcgctaatgataatctcaatgcttctactgctgagctttttgcg
aatggtggctccggaaagtctgaagacggaaagtggtataacgctatcaaaaaccgactt
caactttggccagagggcagaatcccatacacgatttcgtctcaatacagctcttacagt
cgttctctgatagctgcgtctatgcaagagtatgcatcacatacttgcatcagatgggtt
ccaaaagaggcagctgatgtcaactacgtccacatctacccagacagaggatgttactcg
atggtgggaaagatgggaggaaagcaatcgctatcacttggttctggttgtattcaaaaa
ggaatcattcttcacgagttgatgcacgccgttggttttttccacgaacaatcccgaact
gatcgtgacgatcatatcacaattatgtggaacaatattcaagcaggaatgcagggacag
ttcgagaagtacggccacgggactattcagtcattgggtactggttatgattacggaagt
attatgcattatggaacaaaggctttctcgagaaatggacaaccaactatgattcctaag
aagaatggagccactattggacagagaaatgggttctcaaaagttgacaaatttaagatc
aacactctttatggatgtccagttgaaggagaaaaaccaaccacctccgctccaacatcg
ggaccaatcgttatcactgtgaagccagttgttataacaaccggaaagccgccagtcatt
caaacagtttccccagccgtcccattgaagccaagcgagtgcagaaatcttagaggagat
tgtgatgaccttgctaaacaaggatggtgcatcagaaatccaggttggatgcgtgccaac
tgcccaatttcatgtggaatgtgcattccaaccaaggaaactcagaagccatatgtccaa
actacgacccaagctgcgactacaaccgccagaccacaaaagccagtcacccaaccaatt
caaccccttccaccagtcccgccgcttcctccaactaccccagaagattgtgaggatctt
cgtgtcgattgtcttgtattggtttctcagagatactgcaaaatttcacaaaacttcatg
aaatcttattgtgcaaagagctgcggcttctgcttcaagccacctccaaccgagattccg
gataaccgcccgactgtggtaaccactagaccactagtcacacttccaccagcggtcatc
cggtcgcgttctccggctccgcccgtttccaccacgaccaaggctgctccaacaaccagt
acaactagcgcagctccttactccccaactccactacccagcgagtgctccgatcgcaaa
catttttgctcacactggaagagcgctggattctgtgaaggaatcttcatgaactacatg
aaaaagaactgcccagcatcatgtggcctttgctaa

DBGET integrated database retrieval system