KEGG   Caenorhabditis elegans (nematode): CELE_T04G9.2Help
Entry
CELE_T04G9.2      CDS       T00019                                 

Gene name
nas-15
Definition
Protein NAS-15
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_T04G9.2 (nas-15)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_T04G9.2 (nas-15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(777734..777838,777910..778074,778121..778269,778481..778617,778666..779034,779092..779268,779321..779452,779510..779627,779707..779844,780010..780235)
Genome map
AA seq 571 aa AA seqDB search
MREYVLIFLVAPVFAAILGPYDIPPELPPLNDENFFDRSHSEYETVLTPEDFELGTRITA
AMAHDNGDDIWDSDAMYSKDRFEGDIANDNLNASTAELFANGGSGKSEDGKWYNAIKNRL
QLWPEGRIPYTISSQYSSYSRSLIAASMQEYASHTCIRWVPKEAADVNYVHIYPDRGCYS
MVGKMGGKQSLSLGSGCIQKGIILHELMHAVGFFHEQSRTDRDDHITIMWNNIQAGMQGQ
FEKYGHGTIQSLGTGYDYGSIMHYGTKAFSRNGQPTMIPKKNGATIGQRNGFSKVDKFKI
NTLYGCPVEGEKPTTSAPTSGPIVITVKPVVITTGKPPVIQTVSPAVPLKPSECRNLRGD
CDDLAKQGWCIRNPGWMRANCPISCGMCIPTKETQKPYVQTTTQAATTTARPQKPVTQPI
QPLPPVPPLPPTTPEDCEDLRVDCLVLVSQRYCKISQNFMKSYCAKSCGFCFKPPPTEIP
DNRPTVVTTRPLVTLPPAVIRSRSPAPPVSTTTKAAPTTSTTSAAPYSPTPLPSECSDRK
HFCSHWKSAGFCEGIFMNYMKKNCPASCGLC
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatacgtgctgatatttctagtagccccagtttttgcagccatcttgggtcca
tatgatattccaccagagctgccacctctgaacgatgaaaacttttttgaccgttcccac
tctgaatatgaaactgtgctcaccccagaagactttgagctcggaactcgcatcaccgct
gcaatggctcacgacaacggcgacgacatctgggattcggatgccatgtacagcaaagac
agatttgaaggagatatcgctaatgataatctcaatgcttctactgctgagctttttgcg
aatggtggctccggaaagtctgaagacggaaagtggtataacgctatcaaaaaccgactt
caactttggccagagggcagaatcccatacacgatttcgtctcaatacagctcttacagt
cgttctctgatagctgcgtctatgcaagagtatgcatcacatacttgcatcagatgggtt
ccaaaagaggcagctgatgtcaactacgtccacatctacccagacagaggatgttactcg
atggtgggaaagatgggaggaaagcaatcgctatcacttggttctggttgtattcaaaaa
ggaatcattcttcacgagttgatgcacgccgttggttttttccacgaacaatcccgaact
gatcgtgacgatcatatcacaattatgtggaacaatattcaagcaggaatgcagggacag
ttcgagaagtacggccacgggactattcagtcattgggtactggttatgattacggaagt
attatgcattatggaacaaaggctttctcgagaaatggacaaccaactatgattcctaag
aagaatggagccactattggacagagaaatgggttctcaaaagttgacaaatttaagatc
aacactctttatggatgtccagttgaaggagaaaaaccaaccacctccgctccaacatcg
ggaccaatcgttatcactgtgaagccagttgttataacaaccggaaagccgccagtcatt
caaacagtttccccagccgtcccattgaagccaagcgagtgcagaaatcttagaggagat
tgtgatgaccttgctaaacaaggatggtgcatcagaaatccaggttggatgcgtgccaac
tgcccaatttcatgtggaatgtgcattccaaccaaggaaactcagaagccatatgtccaa
actacgacccaagctgcgactacaaccgccagaccacaaaagccagtcacccaaccaatt
caaccccttccaccagtcccgccgcttcctccaactaccccagaagattgtgaggatctt
cgtgtcgattgtcttgtattggtttctcagagatactgcaaaatttcacaaaacttcatg
aaatcttattgtgcaaagagctgcggcttctgcttcaagccacctccaaccgagattccg
gataaccgcccgactgtggtaaccactagaccactagtcacacttccaccagcggtcatc
cggtcgcgttctccggctccgcccgtttccaccacgaccaaggctgctccaacaaccagt
acaactagcgcagctccttactccccaactccactacccagcgagtgctccgatcgcaaa
catttttgctcacactggaagagcgctggattctgtgaaggaatcttcatgaactacatg
aaaaagaactgcccagcatcatgtggcctttgctaa

DBGET integrated database retrieval system