KEGG   Caenorhabditis elegans (nematode): CELE_T04H1.7Help
Entry
CELE_T04H1.7      CDS       T00019                                 

Gene name
ugt-55
Definition
Protein UGT-55
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cel00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:cel00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cel00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:cel00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cel00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:cel00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:cel00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:cel00983]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(12256684..12256845,12256897..12256980,12257030..12257360,12257412..12257551,12257598..12257726,12257772..12258003,12258248..12258473,12258526..12258760)
Genome map
AA seq 512 aa AA seqDB search
MQLLTLPTLIFIFLNYGTPCLSLRILVYSPRMIPSHVAFVANIANLLGQRGHNVVVVDNV
LRSDISNKLDLKVIEKVVKVETSANVAKLLADQSIPINFWSMRNEPEEQKKVMKQLGIIF
LEQCKYLVSKEETVFNELKHLEFDFGIHEVFDICGIGIFEKLGIRKSVILSSTGMRDIVN
EALGISSQLQDASILSDYGNSIPFYGIRRNLKFHSAWRNFFEVQSKTLEPLFETTSSFEN
LLRFSNLMFLNTHELADAHRPWSRRVHEIGGISFKFPMPLKNEYINLFNKYNSIILVSFG
TTTPSFLMPEKYKNTLINTFQRFPDFLFIWKYEKDDEFTQKNKKGNVVFKKFLPQVDLLE
SRKIKLFITHGGQNSLLETFHSNTRTLITPLFGDQHRNAQIALENGLSHVLLKDQLANEE
LVYAAIKQGTESNKKLDDNLLKLSSNLKNAKQTSENLFLDTVESTYTDNLSPLNFEFYPK
LYSSDQILLYLDSIAMFTLTLLTMILIRKFLL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttctgactttacccactcttatttttattttcttgaattatggtacaccatgt
ctttcacttcgaattcttgtatactctccacgaatgataccgagccatgtggcatttgtg
gcaaatatagctaatcttcttggtcaacggggccacaatgttgtagttgtagataatgtg
cttcgcagtgatatttcaaacaaattagatttgaaagttattgaaaaggttgtaaaagtt
gaaacgtcggcaaatgttgcaaaattgcttgctgatcaaagtattcccataaacttttgg
agtatgcgaaatgaaccagaggaacagaagaaggttatgaaacaattgggaattatattt
ttagaacaatgtaaatatttggtatcaaaagaagaaaccgtgtttaatgaattgaaacat
ttggaatttgattttggaattcatgaagtttttgatatttgtggaattggaatttttgaa
aaactgggtatccgaaaatctgtgatattgtcttcaactggaatgagagatattgttaat
gaagctcttggtatttcgagtcaattgcaagatgcttcgattctttctgattatggaaat
agtattcctttctatggaatacggagaaatttaaaatttcattctgcctggagaaacttt
tttgaggtacagagcaagacgttggagccactttttgaaacaactagcagctttgaaaat
ctcctccgatttagcaatctaatgtttttgaacacccatgagctcgcagatgctcatcga
ccatggagcaggagagttcatgaaattggaggaatatcctttaaatttccaatgccactg
aaaaacgaatatatcaatctattcaataaatataattccataatccttgtgtcattcgga
actacaacaccttcgtttttgatgcccgagaaatataaaaatacgttaataaatactttc
caaaggtttcctgactttcttttcatttggaaatatgagaaagacgacgagttcacacag
aaaaataagaaagggaatgtggttttcaagaagtttttgcctcaagttgatttattagaa
tcaagaaaaatcaaattattcatcacacatggcggtcagaatagtcttcttgaaactttt
cattcaaacactcgtactctgataactcccttatttggtgatcaacacaggaacgctcaa
attgcattggaaaacggattgagtcatgttttactcaaagatcaactagcgaatgaagaa
ttggtttatgcagcaataaaacaaggaactgaaagtaacaaaaaactagatgacaacttg
ttaaaattatcttcaaatttgaaaaatgcgaaacaaacttccgaaaaccttttcctggat
actgttgaatctacatacactgataacttatcgcctcttaactttgagttttatccaaaa
ttgtattcctctgatcaaattcttttatatttagactcaattgccatgtttactctgaca
ttgttgacaatgatattaattagaaagtttcttctataa

DBGET integrated database retrieval system