KEGG   Caenorhabditis elegans (nematode): CELE_T04H1.8Help
Entry
CELE_T04H1.8      CDS       T00019                                 

Gene name
ugt-56
Definition
(RefSeq) Putative UDP-glucuronosyltransferase ugt-56
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CELE_T04H1.8 (ugt-56)
   00053 Ascorbate and aldarate metabolism
    CELE_T04H1.8 (ugt-56)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_T04H1.8 (ugt-56)
   00860 Porphyrin and chlorophyll metabolism
    CELE_T04H1.8 (ugt-56)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_T04H1.8 (ugt-56)
   00982 Drug metabolism - cytochrome P450
    CELE_T04H1.8 (ugt-56)
   00983 Drug metabolism - other enzymes
    CELE_T04H1.8 (ugt-56)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CELE_T04H1.8 (ugt-56)
Glycosyltransferases [BR:cel01003]
 Others
  Hydrophobic molecule
   CELE_T04H1.8 (ugt-56)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
V:join(12258998..12259147,12259388..12259555,12259622..12259862,12259911..12260191,12260284..12260518,12260567..12260792,12260837..12261110)
Genome map
AA seq 524 aa AA seqDB search
MLWAFIVWLGALCIYGSAFDILIYAPRMMQSHVYFTARIANVLAARGHKVTVIDNVFRYD
VDNELSSDIHEIISVEPSPEVTKLLNTGSLPTILWNSKASPEEQRTIMEGLGHVHRLQCT
HLIENSTLIPKLQEIKFDFAIHEVFDSCGVGILEVIGVQKTVIVSSTGPMDVVPITLGIS
DTLNTPSLLSDYGSYLSFFEKRRNLKFLSGMLNFHEMQDSMISPLFKKYYGLKKPTGEIM
RQANLLFYNIHEGSDGMRMRGRRSFDIGGIAFKDQKNLTMEYQTLLSDPRPKVLVSFGTA
ATSSHMPQNLKNSLMTAMKQMNNVLFIWKYEMEDNFTKQEELTTNIIFKKFLPQTDLLAS
SKIDLFVTHCGQNSLLEAFNSGVRVLAVPLFGDQHRNAKLAFENGLIEILPKSDIETPAK
IVKAVKTGLEPNAKLDQNIVLISSLLRNSKENAENLLISTIEATYSTEFPPNFSKFPKNY
HPNTLVRLIDSSIALVFMLFIFVFVNHFRKNYVGFKYPLSFSTK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgggctttcatcgtttggctcggtgctctttgcatttatggatcagcttttgat
attctgatttatgctccacgaatgatgcagagtcatgtgtatttcacggcaaggattgcg
aatgtgcttgcagcaagaggacacaaggtgacagtaattgataacgtattccgatacgac
gtcgataacgaactatcatcagatattcatgaaatcatctcagttgaaccaagccctgaa
gtcactaaactacttaacaccggtagtttgcccacaatattatggaactcaaaagcatca
ccggaagaacaacgaactataatggaaggccttggtcatgtacatcgtcttcaatgcact
cacctaattgagaatagcacactgattcctaaactacaagaaattaaatttgactttgca
attcatgaagtattcgattcttgtggagtcggtattcttgaggtaatcggtgtacagaag
actgttattgtatcatcaactggaccaatggatgttgtcccaattacacttggaatatct
gatacattgaacactccatctctattatcggattatggaagttacctatcattttttgaa
aaacgaagaaatctcaagtttctatctggaatgctcaatttccacgaaatgcaggactca
atgatatctccgcttttcaaaaaatattatggattgaaaaaacctactggtgaaataatg
agacaagcaaatttattgttttataatattcatgaaggatcagatggaatgagaatgaga
ggacgaagaagttttgatattggagggattgcttttaaggatcaaaagaatttgactatg
gagtatcaaactcttctctctgatcctcgtcctaaagtgctcgtatcatttggtactgca
gccacatcatctcatatgcctcaaaatttgaaaaattcgttgatgactgcaatgaaacaa
atgaacaatgttttgttcatatggaaatatgaaatggaagataatttcacaaaacaggag
gagctcacaacaaatataattttcaaaaagtttttgccgcagactgatttattagctagc
agcaaaattgacctgtttgttacccattgtggccagaacagcttacttgaagcatttaat
tctggagttcgagtgttagcagttccactatttggagaccaacaccgaaatgcaaagctt
gcctttgaaaatggattaattgaaattcttccgaaatctgacatcgaaactccggcgaaa
attgtgaaagccgtcaaaacaggactggaaccgaatgcaaaactggatcaaaacattgtt
cttatttcttctcttttaagaaattcgaaagaaaacgccgagaacctactgatttccaca
atcgaagctacatattcaacagagtttccaccgaatttttccaaatttccaaaaaactat
cacccaaataccttggttcgactaattgattcatcgattgctttagtttttatgcttttt
atttttgtttttgtaaaccattttagaaaaaactatgtaggatttaaatatccattgagt
ttttcaacaaaataa

DBGET integrated database retrieval system