KEGG   Caenorhabditis elegans (nematode): CELE_T05G5.6Help
Entry
CELE_T05G5.6      CDS       T00019                                 

Gene name
ech-6
Definition
Protein ECH-6
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:cel01200]
Metabolism; Overview; Fatty acid metabolism [PATH:cel01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cel00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cel00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:cel00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cel00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cel00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cel00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cel00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cel00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(9751608..9751661,9751884..9752182,9752231..9752441,9752488..9752790))
Genome map
AA seq 288 aa AA seqDB search
MMRFSSMLVRNAKLCANVNQMQVAAFSSKAPEMIKIEKVGEKQNVALIKLNRPKALNALC
AQLMTELADALEVLDTDKSVGAIVITGSERAFAAGADIKEMTNNEFATTFSGSFLSNWTA
VSDVKKPVIAAVNGFALGGGNELAMMCDIIYAGEKARFGQPEINIGTIPGAGGTQRWARA
AGKSFAMEVCLTGNHVTAQEAKEHGIVSKIFPADQVVGEAVKLGEKIADQSPLIVQMAKE
AVNKAYELTLQEGLHFERRLFHATFATKDRKEGMTAFAEKRKPQWESK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcttctcgtcgatgctggttcgcaatgccaaattgtgtgcaaatgtcaaccaa
atgcaagtcgccgcattttcaagcaaagctcctgaaatgatcaagatcgagaaagttgga
gagaagcaaaatgttgctcttatcaagctgaatagaccaaaagctttgaatgctttgtgc
gctcagcttatgactgaattggctgatgctctcgaagttttggatactgataagtctgtc
ggagcaattgtgattactggaagtgagagagcttttgccgctggagctgatatcaaggag
atgaccaataacgagttcgccaccacattttctggaagcttcctctccaactggaccgct
gtcagtgatgtgaaaaagccagttattgctgcagtgaacggatttgcattgggaggtgga
aacgagttggcaatgatgtgtgatattatctatgccggagagaaggctcgttttggacaa
cctgaaattaacattggaactattccaggagcaggaggtactcagcgttgggctcgcgcc
gccggaaaatcatttgccatggaggtgtgccttactggaaaccacgtgactgctcaagaa
gctaaggagcacggtattgtgagcaagattttcccagctgatcaggttgtcggggaagct
gtgaaacttggagagaaaatcgctgatcaatctccactgattgttcaaatggcaaaggag
gccgttaacaaagcttatgagcttactcttcaagagggacttcacttcgaaagacgactt
ttccatgccacttttgccaccaaggatagaaaggaaggaatgaccgcttttgccgagaag
agaaagccacagtgggagtcgaaatag

DBGET integrated database retrieval system