KEGG   Caenorhabditis elegans (nematode): CELE_T05G5.6Help
Entry
CELE_T05G5.6      CDS       T00019                                 

Gene name
ech-6
Definition
(RefSeq) Probable enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00062  Fatty acid elongation
cel00071  Fatty acid degradation
cel00280  Valine, leucine and isoleucine degradation
cel00310  Lysine degradation
cel00380  Tryptophan metabolism
cel00410  beta-Alanine metabolism
cel00640  Propanoate metabolism
cel00650  Butanoate metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01212  Fatty acid metabolism
Module
cel_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cel_M00085  Fatty acid biosynthesis, elongation, mitochondria
cel_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CELE_T05G5.6 (ech-6)
   00650 Butanoate metabolism
    CELE_T05G5.6 (ech-6)
  Lipid metabolism
   00062 Fatty acid elongation
    CELE_T05G5.6 (ech-6)
   00071 Fatty acid degradation
    CELE_T05G5.6 (ech-6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CELE_T05G5.6 (ech-6)
   00310 Lysine degradation
    CELE_T05G5.6 (ech-6)
   00380 Tryptophan metabolism
    CELE_T05G5.6 (ech-6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CELE_T05G5.6 (ech-6)
Enzymes [BR:cel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CELE_T05G5.6 (ech-6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 176376
NCBI-ProteinID: NP_499156
WormBase: WBGene00001155
Ensembl: WBGene00001155
UniProt: P34559
Position
III:complement(join(9751693..9751746,9751969..9752267,9752316..9752526,9752573..9752875))
Genome map
AA seq 288 aa AA seqDB search
MMRFSSMLVRNAKLCANVNQMQVAAFSSKAPEMIKIEKVGEKQNVALIKLNRPKALNALC
AQLMTELADALEVLDTDKSVGAIVITGSERAFAAGADIKEMTNNEFATTFSGSFLSNWTA
VSDVKKPVIAAVNGFALGGGNELAMMCDIIYAGEKARFGQPEINIGTIPGAGGTQRWARA
AGKSFAMEVCLTGNHVTAQEAKEHGIVSKIFPADQVVGEAVKLGEKIADQSPLIVQMAKE
AVNKAYELTLQEGLHFERRLFHATFATKDRKEGMTAFAEKRKPQWESK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcttctcgtcgatgctggttcgcaatgccaaattgtgtgcaaatgtcaaccaa
atgcaagtcgccgcattttcaagcaaagctcctgaaatgatcaagatcgagaaagttgga
gagaagcaaaatgttgctcttatcaagctgaatagaccaaaagctttgaatgctttgtgc
gctcagcttatgactgaattggctgatgctctcgaagttttggatactgataagtctgtc
ggagcaattgtgattactggaagtgagagagcttttgccgctggagctgatatcaaggag
atgaccaataacgagttcgccaccacattttctggaagcttcctctccaactggaccgct
gtcagtgatgtgaaaaagccagttattgctgcagtgaacggatttgcattgggaggtgga
aacgagttggcaatgatgtgtgatattatctatgccggagagaaggctcgttttggacaa
cctgaaattaacattggaactattccaggagcaggaggtactcagcgttgggctcgcgcc
gccggaaaatcatttgccatggaggtgtgccttactggaaaccacgtgactgctcaagaa
gctaaggagcacggtattgtgagcaagattttcccagctgatcaggttgtcggggaagct
gtgaaacttggagagaaaatcgctgatcaatctccactgattgttcaaatggcaaaggag
gccgttaacaaagcttatgagcttactcttcaagagggacttcacttcgaaagacgactt
ttccatgccacttttgccaccaaggatagaaaggaaggaatgaccgcttttgccgagaag
agaaagccacagtgggagtcgaaatag

DBGET integrated database retrieval system