KEGG   Caenorhabditis elegans (nematode): CELE_T05H10.1Help
Entry
CELE_T05H10.1     CDS       T00019                                 

Gene name
T05H10.1
Definition
Protein T05H10.1
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(8042537..8042815,8042862..8043723,8043771..8044051,8044096..8044902,8044950..8045273,8045383..8046206,8046249..8046558,8046602..8046666,8046747..8046975)
Genome map
AA seq 1326 aa AA seqDB search
MVRVEDSNGADTDTNPEGESSGYVRLAGNGLPGGEQQQASSSGVAAAPSVDSSPGRSVPL
AIASSSSPANVANNQYAIPVDENGHRYVGLVNQAMTCYLNSLVQSLYMTPEFRNAMYDWE
YVQQPAHIKEQRKKAEQSIPCQLQKLFLLLQTSENDSLETKDLTQSFGWTSNEAYDQHDV
QELCRLMFDALEHKWKGTEHEKLIQDLYRGTMEDFVACLKCGRESVKTDYFLDLPLAVKP
FGAIHAYKSVEEALTAFVQPELLDGSNQYMCENCKSKQDAHKGLRITQFPYLLTIQLKRF
DFDYNTMHRIKLNDKMTFPDVLDLNDYVNKEKRSTTSSAWQQIGKNKSENEEDDMELGSP
NPKRCTPGVQSPNRYQGSENVCVGQPIDHAAVDDIVKTSGDNVYELFSVMVHSGNAAGGH
YFAYIKNLDQDRWYVFNDTRVDFATPLEIEKSFGGHPSGWNQSNTNAYMLMYRRIDPKRN
ARFILSNQLPQHIKDSQEKWKRLEREAEDERLRKLSLIQVYVTINYPFPSVVTLPDKKQL
DLTPQKYQIAEDFGEYKTEISREMPIKNVFNHAFEFFNERARAYNLPFTKNSARLIYVEH
GSLMMDFKSKADMDKKLRSVFNVNHGEPGSMYGVHFILDVRIASSFFPVDIKNKITIKVQ
RVDIGKKTTANELIVVVDANEKMIKVKSWIGGQFRDDIHGVLNARVVLEVASSRCEFMMI
DVSHNATEFGSLIQQYVGHTTPTLYYDGGLNTMVTKESQEATLADRKLPFDKSVMYHILD
RKCFSTMVKVRLPSQEEIEKAASTKNAYQGPTWAETIAIMKEEDRLWNEPRAAVEVMSTV
SRTDTTDHALVADTDDEPIPSGRGSTASMRSVSMDDIDADIGISGSLCNNTPQMSPCVSE
GDDADESQLDGKSQLMSDYMQKTSPDFYYNRDPQNHLNKNLKIALGDETPSESLSAVSSG
QSTLVPSTSNQALSSMTRSDEAVDGKIVTVFSHENFHKLDVDSRMRVLEFKKWVAEQLEM
DKDQFVIVKHASDDGSDSGYEANFMDDETVSGAFQSCFISIKLRAPLKSDEKMMQIILFD
ILENLRENWKPLFELPVSQSTVIGDVLLQCLRMYKEVYGEELTPKMVRLRELGGSGVGTG
RAVLNPNDTLEKRSYNWCSHLYLQIITDEAMIGKPGEPIMVRRFRPSTVEVNPTHEVLVD
ANAENPVVSFVEALSKISGIPVERLAITDLKEFNWQKWPYLKSRLDMLENKVNFTKDLQV
TYPLPREFLDKVGSRVLYYKDSDEEAKVLSEDERKQIKIKENGQSANANRRKERPLRIQM
SSVCEA
NT seq 3981 nt NT seq  +upstreamnt  +downstreamnt
atggtacgggtcgaggactcgaacggcgcagatacagataccaatccagaaggtgaatcc
tcaggttatgtccgtttggctggcaacggacttcctggcggcgagcaacaacaagcaagc
tcttcaggggtagctgcggcaccatctgtcgatagcagccctgggcgatcagttccgttg
gctattgcttcgtcatcatcaccggccaatgtagcaaataatcaatatgcgattccagtc
gatgaaaacggacacagatatgtcggtcttgtgaaccaggcaatgacttgttatttgaac
agtcttgtgcaatctctctacatgactccggaatttcgaaatgctatgtacgattgggaa
tatgttcaacagccagcccatattaaagaacaaagaaaaaaggccgaacagagtattcca
tgtcaacttcaaaaactattcctactgcttcagacatctgaaaatgactccctggaaacg
aaagatctaacgcaaagttttggatggacatcgaatgaagcatacgatcagcatgatgtt
caggaactttgccgtcttatgttcgatgctttggaacacaaatggaaaggcaccgaacat
gagaagcttattcaagatttgtacagaggaaccatggaagactttgtagcatgcctcaaa
tgtggacgagagagtgtcaagacggattactttcttgatctaccgttagctgttaaacca
tttggcgcaatacatgcatacaaaagtgtcgaagaagcgttgactgcgtttgttcaacca
gaacttcttgatggatcaaaccaatacatgtgtgaaaattgcaaaagcaagcaggatgct
cataaaggacttcgaattactcagttcccatatctcctcacaattcaattaaaacgtttt
gatttcgattacaatacaatgcatcgtattaaattaaacgacaaaatgactttccctgat
gttttggatttgaacgactatgtaaacaaagagaagcgatcgacaacatcatcagcttgg
caacagattggaaagaataaatcagaaaacgaagaagatgatatggaattaggatcaccc
aatccaaaaagatgcactccgggagttcaatctccaaatcgttaccaaggaagtgagaat
gtatgtgttggccagccgattgatcacgcagcagtggacgatatagtaaaaacaagcgga
gataatgtgtacgagttgttttctgtaatggttcattctggaaatgctgctgggggacat
tactttgcatatatcaaaaatctggaccaggataggtggtacgttttcaacgatacgcga
gtggattttgcaacccctttggagattgagaagagcttcggtggtcatccgagtggttgg
aatcaatcgaatactaatgcctatatgctaatgtatcgcaggattgatccgaagagaaac
gctcgatttattttgagcaatcaactaccacaacacataaaggattctcaagaaaagtgg
aagagacttgaacgagaggcggaagatgaaagactccgaaaactgagccttattcaagta
tatgttaccatcaactatccattcccatcagttgtcacactcccagataagaagcaactc
gatttgactccacaaaaatatcagattgctgaagattttggtgaatacaagactgaaata
tcacgagagatgccgatcaaaaatgtgttcaatcacgcattcgagtttttcaatgagcgt
gctcgagcctacaacttgccattcacaaaaaattctgctcgtctaatttatgttgagcat
ggtagcctgatgatggatttcaaatcaaaagcagacatggacaagaagttacgaagtgtt
ttcaatgtcaatcacggagagcctggatcaatgtatggagttcacttcattcttgatgtt
cgtattgcttcatcgttcttcccagtcgacattaaaaacaagatcacaatcaaagtgcaa
cgcgtcgacattggtaaaaagacgactgcaaatgagttgattgtcgttgtagatgctaat
gagaagatgattaaagtaaaatcgtggataggaggtcaatttcgagatgatattcatggg
gttttaaatgctcgtgtggttcttgaagttgcttcgtcaagatgcgagttcatgatgatt
gacgttagtcataacgcaacggaatttggaagtctgatacagcaatatgttggacacact
acgcctacgctatattacgatggtggattaaatacaatggtcacgaaagaatctcaagaa
gcaacgctagctgatcgaaagctaccgttcgacaaatcggttatgtatcatattcttgac
agaaaatgtttctcaacaatggtgaaagttcgtttgccatcacaagaggagattgaaaaa
gcagcgtctactaaaaatgcttatcaaggtccaacttgggccgagacaattgccataatg
aaggaagaggacagactttggaatgagccgcgagctgctgtagaagtaatgtcaactgtc
tcgagaaccgacactactgatcatgcacttgtggcggacactgacgatgagccaattcct
tccggaagaggttcaactgcttctatgcgttccgtcagcatggatgatattgatgctgat
attggaatatctggaagcttatgcaataatactccacaaatgtccccatgtgtatcagaa
ggcgatgacgctgacgaaagtcaattagatgggaagtctcagttgatgagtgattacatg
cagaagacaagtcctgatttctattacaatcgagatccacaaaatcatttgaacaagaac
ttgaaaatagcacttggagatgaaacaccatcagaatccttgtcagctgtgagtagcgga
caatccacactggttccttcaacttcgaatcaagctttgtcaagtatgacacgatccgat
gaagctgttgatgggaagattgtgactgtattttctcatgaaaactttcacaaacttgat
gtcgatagtcgaatgcgagttctagagttcaaaaagtgggtagctgaacaattggagatg
gacaaagatcagtttgtcatagttaagcatgcatctgatgatggatccgacagtggatat
gaagctaatttcatggatgatgagactgtttctggggcctttcagtcatgtttcatttcg
atcaaactacgcgcaccattaaaaagcgatgaaaaaatgatgcagattattctattcgac
attctagaaaatctgcgagaaaattggaaaccattatttgaacttcccgtgtctcaaagt
acagttattggagatgttcttctgcaatgtctgcgtatgtacaaggaggtttatggagaa
gaattgactccaaaaatggttcgtctgcgcgagttgggtggatcgggagttggaactgga
agagcagtactaaatcctaatgatacattagaaaaacgatcttataactggtgttctcat
ctatatctgcaaatcataactgatgaagcaatgattggaaaacctggcgagccgatcatg
gttcgaagattccgcccgtctaccgttgaagtcaatcctacacacgaagttctagttgat
gcaaatgccgagaacccagttgtatcatttgtggaagcattgtcaaaaatttcgggaatt
ccggtggaacgtcttgcaattactgatctgaaagaattcaattggcagaaatggccgtac
ttgaagagtcgcctcgatatgcttgaaaacaaagttaacttcacgaaagacctccaagtg
acttatccacttccccgagaattcttagacaaggtcggaagtcgagttctatactacaaa
gattctgatgaagaggcaaaagttctgtcagaggatgagcgtaaacaaattaaaatcaaa
gaaaacgggcaatctgcaaacgcaaatcgtagaaaggaacgaccgcttcgaattcaaatg
agcagcgtctgtgaagcttaa

DBGET integrated database retrieval system