KEGG   Caenorhabditis elegans (nematode): CELE_T05H4.4Help
Entry
CELE_T05H4.4      CDS       T00019                                 

Definition
Protein T05H4.4
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_T05H4.4
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CELE_T05H4.4
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(6438919..6439014,6439059..6439220,6439270..6439434,6439480..6439839,6439891..6440019)
Genome map
AA seq 303 aa AA seqDB search
MVENNTLAITGGVVLISSVSLFLYLRQLRAEKKSKRTLEDDSVKYLLPLIEKFEISHNTR
KFRFGLPSKDHILGLPIGHHVYLSANIGGKLIVRSYTPVSCDLDLGYVDLMVKVYFKNTH
ERFPDGGKMSQHLESLKIGDTVSFRGPHGSIIYKGSGLFTVRMDKKAEPKNRFFKHLSMI
AGGTGITPMLQVIAAILRDPIDATQIRLLFANQTEDDILCRKELDELAEKHPTRFRVWYT
VSKASKDWRYSTGHINEEMIKEHLFPSNEESAVLLCGPPAMINCACIPNLDKLGHNSENY
LIF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaacaatacacttgcgataactggaggcgtggtacttatttcaagtgtttct
ctatttttgtatttgagacaactcagggctgaaaaaaaatcaaaaagaacgcttgaagac
gattcggtcaaatatttgcttcctctcatagaaaagttcgagatcagtcacaatacgaga
aaattccgattcggattaccatcgaaggatcatattctaggacttcccattggacatcat
gtgtatcttagtgccaatattggtggaaagcttatagttcgatcctataccccagtgtct
tgtgacttagacttgggatatgtagatttgatggttaaagtgtattttaagaatacacat
gaaagattcccggatggtgggaaaatgagccaacatttggagagcctcaagattggagat
actgttagcttccgtggtccacatggaagcataatttataagggaagtggtctattcact
gtacgaatggataagaaggccgagccaaagaatcgatttttcaagcatctttccatgatt
gctggaggtaccggaatcacaccgatgcttcaagtcattgccgccattcttcgtgatcca
attgacgctactcagatcagacttctgtttgcaaatcagaccgaagacgatattctgtgc
aggaaagagctcgacgagctagccgagaagcatccaactcgtttccgtgtatggtatact
gtaagcaaagcgtcaaaagattggagatattctacagggcatataaatgaggaaatgatc
aaggaacatctattcccttccaatgaggaatctgctgtgctgttgtgtggaccaccagca
atgatcaactgtgcgtgcattccaaatcttgataagcttggacacaattcagaaaattac
cttatattctag

DBGET integrated database retrieval system