KEGG   Caenorhabditis elegans (nematode): CELE_T05H4.5Help
Entry
CELE_T05H4.5      CDS       T00019                                 

Gene name
hpo-19
Definition
(RefSeq) NADH-cytochrome b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_T05H4.5 (hpo-19)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CELE_T05H4.5 (hpo-19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 179029
NCBI-ProteinID: NP_504638
WormBase: WBGene00020268
Ensembl: WBGene00020268
UniProt: O16521
Position
V:join(6436647..6436760,6436817..6436978,6437025..6437189,6437243..6437602,6437655..6437783)
Genome map
AA seq 309 aa AA seqDB search
MVENNTLIITGGVVVVSSIAIYIYLKATNTCPFSLCKKSKKRTLVDDSVKYPLPLIEKFE
ISHDTRKFRFGLPSKDHILGLPIGQHVYLTANIDGKIIVRPYTPVSSDEDLGFVDLMVKV
YFKNTNEKFPEGGKMSQHLESLKIGDTINFRGPQGNIVYKGHGLFSIKADKKAEPKNRVF
KHLSMIAGGTGITPMLQVIAAILRDPTDTTQIRLLFANQTEDDILCRQELDDLAKEHPTR
FRVWYTVDRPPVMWSYSSGFINDSMIKENLFPPGDDSAVLLCGPPPMINFACIPNLEKLE
YDPANRLLF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaataacactctcataatcacaggaggagtggtcgtagtttcgagtattgct
atctacatttatttgaaagcaacaaatacatgccccttctcactttgtaaaaagagcaag
aaacgaactcttgtcgatgattctgtcaagtatccacttccgttgattgaaaagttcgag
atcagtcatgacacgagaaaattccgattcggattaccatcgaaggatcatattcttggg
cttccaatcggccaacacgtttacctcaccgcaaatattgatggaaagattatcgttcgc
ccatatactccagtatccagcgatgaagatctaggattcgttgatttgatggtgaaggtt
tacttcaagaacacaaatgagaaattcccagaaggtggaaaaatgagtcaacatttggag
agcctcaagattggagacacgatcaatttccgcgggccacaaggaaatattgtttacaaa
ggtcacggattgttcagcatcaaagccgataagaaggccgagccgaagaatcgagttttc
aagcatctttccatgattgctggaggaaccggaatcacaccaatgcttcaagtcattgct
gccattcttcgtgatccaactgacaccactcagatcagacttttgtttgcaaatcagact
gaggacgatattctgtgcagacaggaacttgacgatcttgcaaaggagcatccaactcgt
ttccgtgtatggtatacagtcgatagaccaccagtgatgtggagctattcctctggattc
atcaatgacagcatgatcaaggaaaacctcttcccacctggcgatgattctgctgttctc
ttgtgcggaccaccaccaatgatcaactttgcttgcattccgaaccttgagaagctcgaa
tacgacccagcaaatcgtcttctcttctag

DBGET integrated database retrieval system