KEGG   Caenorhabditis elegans (nematode): CELE_T07C5.1Help
Entry
CELE_T07C5.1      CDS       T00019                                 

Gene name
ugt-50
Definition
Protein UGT-50, isoform C
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CELE_T07C5.1 (ugt-50)
   00053 Ascorbate and aldarate metabolism
    CELE_T07C5.1 (ugt-50)
   00500 Starch and sucrose metabolism
    CELE_T07C5.1 (ugt-50)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_T07C5.1 (ugt-50)
   00860 Porphyrin and chlorophyll metabolism
    CELE_T07C5.1 (ugt-50)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_T07C5.1 (ugt-50)
   00982 Drug metabolism - cytochrome P450
    CELE_T07C5.1 (ugt-50)
   00983 Drug metabolism - other enzymes
    CELE_T07C5.1 (ugt-50)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CELE_T07C5.1 (ugt-50)
Glycosyltransferases [BR:cel01003]
 Others
  Hydrophobic molecule
   CELE_T07C5.1 (ugt-50)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(12691737..12691907,12692182..12692380,12692508..12692607,12692666..12692736,12692790..12692935,12693852..12694028,12694070..12694229,12694285..12694365,12694411..12694559,12694617..12694687,12695313..12695559)
Genome map
AA seq 523 aa AA seqDB search
MHYSQMRWMFFCLTALLHGSFIVNAAKILVYCPSISKSHVLLCSKYADLLHNAGHDTVLF
IPSYSKLLDNYDGAKHAKVWRLHNVTEAYDTKLGTLANVMENSHIGFIDRLTFDADFWID
MCADLLGKLPEMQHIIDYKFDLVIYNEIDPCTPAIVRLFNIPKTVLLSSEAIMDKVAWNL
GLPTLPSYVPSVEENPNHDRMSFFERMSNVYKFFQSIVVHYLQDIHVLNLFRKEVSSDFP
SIAEIIRNVSLVLVNTDEIFDLPRSYSSKFVYVGMLEAGKDENVTLPKKQDDYFKKGKSG
SVFVSFGTVTPFRSLPERIQLSILNAIQKLPDYHFVVKTTADDESSAQFFSTVQNVDLVD
WVPQKAVLRHANLKLFVSHGGMNSVLETMYYGVPMVIMPVFTDQFRNGRNVERRGAGKMV
LRETVVKETFFDAIHSVLEEKSYSSSVKRISHLMKNKPFTSEERVTKWIDFVLKYETSEH
FDLESNNLSIIEHNHLDLFFYLCIISLLNFVVYRKIFKRKSQS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcactactcgcaaatgaggtggatgttcttttgtttgacagcactgcttcacggtagc
ttcatcgtcaatgctgccaaaattctggtctattgtccgtccattagtaagagccacgtt
cttttgtgctctaagtatgccgaccttcttcacaatgcgggacacgacacggtgcttttc
attccttcctattcgaaactactggacaactatgacggtgcgaaacacgccaaagtgtgg
agacttcacaacgtcaccgaggcgtatgatacaaaattgggtactttggccaacgtgatg
gagaactctcacatcggattcatcgaccgcctgacatttgatgccgatttttggatagat
atgtgtgcagatctacttggaaaactgcctgagatgcagcatatcattgactacaagttc
gacttggtcatctacaacgagattgacccatgtactccggctatagtgaggttgttcaac
atcccaaagacagtgctactctccagcgaggccatcatggacaaggttgcgtggaaccta
gggttgcccacactcccgtcgtatgtgccgagcgtcgaagagaatccgaaccacgatcgg
atgagcttttttgaacgaatgtcgaatgtctataaatttttccaatccattgttgtccat
tatctgcaagatatacatgtcctaaatttgttccgtaaagaagtgagttccgattttccg
tcaattgctgaaatcataagaaacgtttcacttgttctggtcaataccgatgaaattttt
gatcttccgcgttcatattcgtcaaagtttgtctatgtaggaatgctagaagctggaaaa
gatgaaaacgttacactccccaagaagcaagatgattacttcaaaaaagggaaatctgga
tcagtgtttgtatcattcggcacagttaccccgttccgttcacttcccgaaagaattcag
ctgtctattttaaatgcgatccagaaactgccggattatcattttgtagtaaaaacaact
gcggatgacgaatcttctgcacaattcttctcaactgttcaaaatgttgatttggtggat
tgggtaccacaaaaggcagttttgagacatgcaaacctgaaactatttgtgtctcacgga
ggaatgaatagtgtacttgagaccatgtactatggagttccaatggttataatgccagta
ttcactgaccaatttagaaatggaagaaatgttgagagacgtggagccgggaagatggtg
ctaagagaaaccgttgtgaaagagacatttttcgacgcgattcacagtgttttggaagag
aaaagctactcctcgagtgtgaagcgaatttctcatcttatgaaaaacaagccattcact
tctgaagaacgtgttacaaaatggatcgattttgtgctcaaatacgaaacctccgaacac
tttgacctggaaagcaacaacttatcaattattgaacacaatcatcttgaccttttcttt
tatttgtgcataatctccctccttaatttcgttgtctaccgtaaaatcttcaagcggaaa
tcccagtcttaa

DBGET integrated database retrieval system