KEGG   Caenorhabditis elegans (nematode): CELE_T10G3.5Help
Entry
CELE_T10G3.5      CDS       T00019                                 

Gene name
eea-1
Definition
Protein EEA-1, isoform B
Orthology
K12478  
early endosome antigen 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Endocytosis
Phagosome
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cel04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:cel04145]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(13491351..13491572,13491964..13492139,13492188..13492461,13492777..13493040,13493088..13493315,13493361..13493690,13494711..13495598,13495927..13496001,13496096..13497031,13497079..13497252,13497309..13497353))
Genome map
AA seq 1203 aa AA seqDB search
MLRRLKEQVSQVANDIDGRLNNSRPSISSQGSQSQSQKSENDQEIEGFLCPMCMVELGGP
DELTVHFEKEHSDTSANRNHPDYTPPQQAPLAFATKDQEIEELRIRVNEEKRFAERIKEE
LDNIKSVMAIASEVTEDEIPYMAQQIQVLTADKGMVTRQFLELEKESGQQSRELQQVKQE
RGDLMAKLKQMSVTMREITDESESGKVEMEDLKRELKVVKSDVVRYEIEVSRLEKMLDQR
PSEDDVNVLRTELVNAQKLMDAISQEKDIEIKEHLNSIRNLSMEREKQHIVNENLEKKIG
EGEETVKQLQISYDAQSEELKQRNERVVQLEARIEENVFELSENKQNVKRLEDKVQESQD
ALQMLSNINGSNEEQMISLNSKFERNTAERKRIEAVFEEKVTVQGERLKTLEMANLDLTN
ELASMGSLLDKERSLLEEKNKEISERDSSINDLKEKLAESEKKATKYKNELKEHADLVEN
LTLQLNKLQENSKDLMEKISAGEGGAKMAIEQLEQEKVKLTNELQTSSEKTKKASGELEA
KISELEKKLRDAEASRTDKEQKWKQEKESFERKLAEAEDEIKRKGERFVEMEKEMEEERQ
KATDRTLKLKDALVNSEKNLETIKKESEDREKIVREKDAHLEENKKRIEDAVQKLEEAEK
RARELEASVSSRDTTVSTKESELSELKGKLTESNSFIEELKVQVEKVSNEISEKQQEVEN
LMAEMRDKEAHWKTKRDEFEAQMLRNQEDNEEASSTLKSVQEQLMKEKETSGEEKNQLIS
VKSQLEELKTEVERLIRSEEEKTQEIEKLKSAVTATTQERDELTATSESLRTECENLNSK
IQSIEESRRHAEEKGSENLERMITEKSRLEKDIEERESTIQSIQEALETKDNEIESLKTT
QRVVEDELVSKISHIESFNSRIEEFEKEMASGKRTIERLEAEKAEETEKLVVFTGTQSQK
QEELEKLQKEIQEKETTIARMTSSKTQFEAMFADVQQTLSKEINDKTEEIERLMERIDSL
EKVNHSRIEELESRLTQRERVVESLEADLAAVRNIEQEKLDELQKLKEEFDELKKAETMW
QAEKDMLIERCLGSESDIEYEKERSQENKRRFDDALSAMHELGRANQSLQIDADRYSSRK
WLDDAEAINCTECGKVFSLTVRKHHCRVCGKIYCNPCSSKSVRIASAKNPVRACNTCFTD
SQK
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaaggttgaaagaacaagtttcgcaagtcgcgaatgatattgacggccgacta
aacaacagtcgaccaagtatttcaagtcaaggttcacagtcgcaatcacaaaaatcagaa
aatgatcaggagatcgaagggttcttgtgcccaatgtgtatggtagagctcggtggtcct
gatgaacttactgttcattttgaaaaagaacattctgacacatcagccaacagaaatcat
cccgattacactccacctcagcaagctccactcgcctttgctacaaaagatcaagaaatt
gaagagcttcgaataagagttaacgaagagaaacgttttgctgaacggataaaagaagaa
cttgataatattaaatcggtaatggcaatagcttcagaagtcacagaagatgagattcca
tacatggcacagcagattcaagttctcacagccgacaaaggaatggttactcggcaattt
ctggaacttgagaaagagagcggccagcagtcccgagaattgcaacaagttaaacaagaa
cgtggagatttgatggccaaattgaaacagatgagcgtcacaatgcgcgaaattacggat
gaatctgaatcgggcaaagttgaaatggaggatctgaaaagagagctgaaagttgtgaaa
tcagatgttgttcggtacgaaatcgaagtttctcggcttgaaaagatgctcgatcagagg
ccttctgaagatgatgtgaatgttttgcgtactgagctagttaatgctcaaaaactaatg
gatgctatttctcaggagaaagatatcgaaatcaaggaacacctaaattcgattcgtaat
ttaagcatggaacgtgaaaaacagcacatcgtaaatgagaacttggaaaagaaaattggc
gaaggagaagaaactgtgaagcagttgcaaatatcgtatgatgctcaatccgaagaattg
aaacaacgaaatgaacgggttgttcaattagaagccagaatcgaagagaacgtgttcgaa
ttaagtgaaaacaagcaaaacgttaaaaggctcgaagataaagtacaagaatcacaagat
gctcttcaaatgttatctaatatcaatggatctaatgaagaacaaatgataagcctgaat
tcaaaattcgagcggaatacagcggagaggaaacgaattgaggcggttttcgaggaaaaa
gtaacagtgcaaggggaaagactaaaaacgcttgaaatggcaaatcttgacctcactaac
gagctcgcctcaatgggatctcttctcgataaggaacgaagtcttctggaagaaaagaac
aaagaaatttcggaacgagactcgtccatcaatgatttgaaagaaaagttggcagaaagt
gagaaaaaagcaacaaagtacaaaaacgagttgaaagaacacgctgatcttgtcgagaat
cttactctccaactcaacaaacttcaagaaaactcgaaagatttaatggagaaaatctca
gccggagaaggtggagccaagatggcaatcgagcaacttgaacaggaaaaagtgaaatta
acgaatgaactccaaacatcgtctgaaaaaactaagaaagcttccggagaacttgaagcc
aaaatttcagaattggagaaaaagctgagagatgctgaagcatcaaggactgacaaagaa
caaaaatggaaacaagaaaaagaatcattcgaaaggaaacttgctgaagctgaagatgaa
attaaaaggaaaggagaaagatttgttgaaatggaaaaagaaatggaagaggaacgacaa
aaggcaactgacagaacattaaagttgaaggatgctcttgtgaattcggaaaagaattta
gaaacaattaaaaaagagagtgaagatcgcgaaaagattgttcgggagaaagacgcacat
ttggaagagaacaagaaacgaattgaagacgcagttcagaagcttgaagaagccgaaaaa
cgagcaagagaattggaagcttcagtttcgagtcgagatacaactgtttcaactaaagaa
tcagagctctccgagctaaagggaaaattgacagaatcgaattcgttcatagaagaactc
aaagtgcaggtagagaaggtgagcaacgagatttccgaaaaacaacaagaagtcgagaat
ctaatggcggagatgcgtgataaggaggctcattggaaaacgaaacgagacgaattcgag
gctcagatgcttagaaatcaagaagacaatgaagaagcttcttcaacattgaaatcagtt
caagaacagttgatgaaagaaaaagagacatctggcgaagaaaaaaatcagctcatctcg
gtcaaatctcagcttgaggaattgaaaacagaagtcgaacggcttattcgttcagaagaa
gaaaagacacaagaaatagaaaaattgaaatcagctgtcacagctactactcaagagcgt
gatgaattgactgcaacatcagagtctcttcgaacagaatgtgaaaatctcaatagcaaa
attcaatccattgaagaaagtcgtaggcatgccgaagaaaaaggatctgaaaatttggag
agaatgattacggaaaagtcaagacttgaaaaagatattgaagaaagggaatccacaatt
cagtcgattcaagaagcattagaaaccaaagataacgaaattgagtctctgaaaactacg
caacgtgtcgtggaagatgagctagtttcaaaaatctcgcacatcgaatctttcaattct
agaattgaagagtttgagaaagaaatggccagtggaaagagaacgatcgaacgattagaa
gcagaaaaagcagaagaaactgagaagcttgtcgttttcactggaacacagagccagaaa
caagaagaattggaaaagttgcagaaggagattcaagagaaggaaactacgattgcaagg
atgacatccagcaaaacacaatttgaagccatgttcgccgacgttcaacagacactttcg
aaagaaataaatgataaaactgaagaaattgaacggctcatggaaagaattgatagcctt
gaaaaggtgaatcattcaagaatcgaagaattagagagcagattgactcaaagagaacga
gtcgttgaatctcttgaagctgatttggctgcagtcagaaatatcgaacaagagaaactt
gatgagttgcagaaattgaaagaagaatttgatgaattgaaaaaagctgaaacaatgtgg
caagcagagaaagatatgctaatcgagcggtgtcttggcagtgaaagtgacattgaatac
gagaaagagagatcacaagagaataagagaagatttgatgatgctctttcagccatgcat
gaacttggaagagccaatcagtcactgcagattgatgccgaccgttacagttctcggaaa
tggcttgacgatgcagaagcaattaattgtaccgaatgtggaaaggtgttttctctgaca
gttcgaaagcatcattgccgagtttgtggaaagatttattgcaatccatgcagttcaaaa
tcagtccgaattgcgagtgccaagaatccagtccgagcctgcaacacgtgcttcactgat
tcccagaaatga

DBGET integrated database retrieval system