KEGG   Caenorhabditis elegans (nematode): CELE_T11F9.3Help
Entry
CELE_T11F9.3      CDS       T00019                                 

Gene name
nas-20
Definition
Protein NAS-20
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_T11F9.3 (nas-20)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_T11F9.3 (nas-20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(11470966..11471250,11471298..11471640,11471693..11472053,11472096..11472178,11472228..11472295))
Genome map
AA seq 379 aa AA seqDB search
MKITVNFLLVALIGVPSVLSDRHITRDKRQAMRDYAKWENNKMSLFFYNLPLEMQAMFRD
AINYLENHTCLKFEYNENAETAVRIRKGNGCYSLYGMHAGEVQDLTLDYNCASFGTAVHE
IMHALGIAHGQARSDRDDYLIVDSTNSNDGIENTENLVPFDYGSVMLYARDPHSDKRIPI
DPEYNFTMGSLRVAFYDMVLLNKFYGCNCDNHPRKLDCKNGGYQNPANCEECLCTDGFNG
QLCDQHEGVYVLEAKKEWDASGVRNNYRKGIETNTMPEYTYFALTAPEGSTIEVRITKLS
GFFCQHTCDYNGVELKYKTDRRIVSPLVCCDNDNLWNKTRSSTNNPFIIAKYGNNRTPHF
EFEYRYIPGNATAAPEENN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagataacagttaattttttgctcgtagctctgattggagtcccttcggtgctttct
gatcgtcatataacccgagataaacggcaagcaatgcgagattatgcaaagtgggaaaat
aataaaatgtctttatttttctacaatttaccacttgaaatgcaagccatgttccgagat
gcgataaattacttggaaaatcacacttgtcttaaatttgagtataacgagaatgcagaa
actgcagttagaattagaaaaggaaatggatgttattcattgtatggaatgcacgcagga
gaagttcaagatcttacattagattacaattgtgcatcttttggaacagctgttcacgaa
atcatgcatgcacttggaattgcccatggtcaagctagaagtgatagggacgattatctt
atagttgattcaactaattcaaatgatggtattgagaacactgaaaatcttgttccgttt
gattatggaagcgtcatgctttatgcacgagatcctcacagtgataaacgaattccgata
gatccagaatataacttcacaatgggaagccttcgagttgcgttttatgatatggtttta
ttgaacaaattctatggctgcaactgtgataatcatccaagaaaattggattgtaaaaat
ggcggctatcagaatccggccaactgtgaagaatgtctttgtactgacggattcaatggt
caattatgcgatcagcatgaaggagtttacgttttggaagctaaaaaagaatgggatgca
tcaggagtgcgtaataattacagaaaaggaattgaaacaaatactatgccggagtatact
tattttgcattgactgctccagaaggatccacaattgaggttcgtatcaccaaactatcc
ggatttttctgtcaacatacatgcgattataatggtgttgaattgaaatacaaaactgat
cgacgaattgtgagcccattagtatgctgtgataatgataatttatggaataagacacga
tcatcaaccaataatccattcattattgcaaaatatggaaataaccgaacacctcacttt
gaattcgaatatcgttatattcctgggaatgctactgctgcgccagaagagaacaattaa

DBGET integrated database retrieval system