KEGG   Caenorhabditis elegans (nematode): CELE_T13H5.5Help
Entry
CELE_T13H5.5      CDS       T00019                                 

Gene name
mrps-18B
Definition
Protein MRPS-18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Ribosome [BR:cel03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    CELE_T13H5.5 (mrps-18B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(8525638..8525736,8525817..8525910,8526010..8526068,8526112..8526192,8526254..8526637)
Genome map
AA seq 238 aa AA seqDB search
MLATGGSFARRLIHSSCRLACEGKTKEVPTPEEAGYAYNHVERKKGMYKPQHSIAEQISY
MKSRGYAEAYKGLPIYRWYKRNIKGQSKLQPPPRLFCIDKHGRFNLNHACPVCRDEYLYF
DYRNPGLIEQFLADGTDQPIDILKSGLCREQYTLLRAQLLKAKEHGTITFGVEFRNFDYR
QWYKSWTDEPGKPVERAGVRLQDIHPDPLVHFPTFKNDKNNDWDEWWIRHDKFAKKAK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgttagccactgggggatcattcgcacgaaggctgattcattcttcctgccgattggct
tgcgaaggaaaaactaaagaagttccgactccagaagaggccggatacgcttacaatcat
gttgaacgaaagaagggaatgtacaaaccacaacacagtattgccgagcagatttcctat
atgaaaagtcgaggatacgcagaggcttacaaaggacttccgatttacagatggtataag
agaaacatcaagggtcaatcgaaacttcaaccacctccaagacttttctgcattgataaa
cacggccgattcaatctaaatcatgcttgtccagtgtgccgtgacgaatatctatacttc
gactaccgaaacccaggtctcattgaacaatttttggcagatggcaccgaccaaccaatc
gatatcctgaagagtggactatgtcgtgaacagtacacgctacttcgtgcacaacttctg
aaagcaaaagaacatggaacaatcacatttggagtagaattccgaaactttgattatcgt
caatggtacaaaagctggacagatgaacctggaaagcctgttgagagagctggtgtacgt
ctgcaagatattcatccagatccacttgttcacttcccaacattcaaaaatgacaagaac
aacgactgggacgaatggtggattcgtcatgataaatttgccaagaaggcaaagtaa

DBGET integrated database retrieval system